Skip to Content
Merck
CN

AV41431

Sigma-Aldrich

Anti-CLDN18 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Claudin 18

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

28 kDa

species reactivity

rabbit, rat, pig, human, canine, horse, guinea pig, mouse, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... CLDN18(51208)

General description

Claudin 18 (Cldn-18), a gastric epithelium-associated claudin, belongs to a large family of transmembrane proteins that are important components of tight junction strands. Cldn-18 normally forms a paracellular barrier against H+ induced inflammation in the stomach. Cldn-18 is a negative regulator of bone resorption and osteoclast differentiation. Claudin-18, an early tumor marker, expression is elevated in several precancers and cancers including pancreatic intraepithelial neoplasias (PanINs), intraductal papillary mucinous neoplasms (IPMNs), mucinous cystic neoplasms (MCNs), and pancreatic ductal adenocarcinomas (PDACs). CLDN18 is involved in intestinal-type epithelial differentiation in the progression of intraductal papillary mucinous neoplasm.

Immunogen

The immunogen for anti-CLDN18 antibody: synthetic peptide derected towards the C terminal of human CLDN18

Application

Anti-CLDN18 polyclonal antibody used to tag claudin-18 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a tumor marker and prognostic indicator for a variety of epithelial cancers.

Biochem/physiol Actions

Anti-CLDN18 polyclonal antibody reacts with pig, canine, human, mouse, rat, and bovine claudin-18 proteins.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Other Notes

Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service