Anti-FBXL5 antibody produced in rabbit

F-box proteins contain an approximately 40 amino acid motif. F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex involved in phosphorylation-dependent ubiquitination. F-box and leucine-rich repeat protein 5 (FBXL5) is an iron sensor that helps regulate iron homeostasis by promoting the ubiquitination and degradation of iron-responsive element-binding protein IRP2.

Synthetic peptide directed towards the middle region of human FBXL5

Anti-FBXL5 polyclonal antibody is used to tag F-box and leucine-rich repeat protein 5 protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of F-box and leucine-rich repeat protein 5 iron homeostasis by degradation of IRP2.

Anti-FBXL5 polyclonal antibody reacts with human, mouse, rat, and bovine F-box and leucine-rich repeat protein 5 proteins.

FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL5 belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats. Alternative splicing of this gene generates 2 transcript variants.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.