biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
28 kDa
species reactivity
canine, horse, rat, mouse, rabbit, human, guinea pig, zebrafish
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... SHH(6469)
General description
Sonic hedgehog homolog (Drosophila) (SHH, HHG1, HLP3, HPE3, SMMCI, TPTPS) is a cell signaling protein, morphogen, involved in vertebrate organogenesis wherein it regulates the growth of limbs and the organization and patterning of CNS and brain structures. SHH initiates hedgehog cell signaling via its interaction with Gli family proteins.
Immunogen
The immunogen for anti-SHH antibody: synthetic peptide derected towards the N terminal of human SHH
Application
Anti-SHH polyclonal antibody is used to tag sonic hedgehog homolog (Drosophila) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of sonic hedgehog homolog (Drosophila) developmental processes such as CNS patterning and limb growth and organization.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
Biochem/physiol Actions
Anti-SHH polyclonal antibody reacts with mouse, human, zebrafish, chicken, rat, and canine sonic hedgehog homolog (Drosophila) proteins.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Rory L Cooper et al.
Evolution & development, 25(1), 54-72 (2023-01-04)
Vertebrate skin appendages are incredibly diverse. This diversity, which includes structures such as scales, feathers, and hair, likely evolved from a shared anatomical placode, suggesting broad conservation of the early development of these organs. Some of the earliest known skin
Vivien Jane Coulson-Thomas et al.
The Journal of biological chemistry, 289(36), 25211-25226 (2014-07-24)
Hair follicle (HF) morphogenesis and cycling are a result of intricate autonomous epithelial-mesenchymal interactions. Once the first HF cycle is complete it repeatedly undergoes cyclic transformations. Heparan sulfate (HS) proteoglycans are found on the cell surface and in the extracellular
Katsunori Nochioka et al.
Acta histochemica et cytochemica, 49(2), 67-74 (2016-05-31)
Choroidal neovascularization is one of the major pathological changes in age-related macular degeneration, which causes devastating blindness in the elderly population. The molecular mechanism of choroidal neovascularization has been under extensive investigation, but is still an open question. We focused
Hong-Xing Dang et al.
International journal of molecular medicine, 40(1), 209-216 (2017-06-01)
The aim of this study was to examine the effect of calcitonin gene-related peptide (CGRP) on primary alveolar epithelial type II (AECII) cells and expression of Sonic hedgehog (SHH) signaling pathway components following exposure to hyperoxia. The AECII cells were isolated and purified from
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service