Skip to Content
Merck
CN

AV44552

Sigma-Aldrich

Anti-CISD2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CDGSH iron sulfur domain 2, Anti-ERIS, Anti-Miner1, Anti-WFS2, Anti-ZCD2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

15 kDa

species reactivity

rabbit, bovine, human, guinea pig, rat, mouse, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CISD2(493856)

Immunogen

Synthetic peptide directed towards the N terminal region of human CISD2

Application

Anti-CISD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

CISD2 (nutrient-deprivation autophagy factor-1, NAF-1) is a zinc finger protein that belongs to the novel Fe-S protein NEET family. It localizes to endoplasmic reticulum and inner mitochondrial membrane and is involved in calcium homeostasis and suppresses beclin-1-dependent autophagy. Mutations in CISD2 gene have been implicated in Wolfram Syndrome 1 and developmental delays.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sagi Tamir et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(14), 5177-5182 (2014-04-08)
Life requires orchestrated control of cell proliferation, cell maintenance, and cell death. Involved in these decisions are protein complexes that assimilate a variety of inputs that report on the status of the cell and lead to an output response. Among
Sagi Tamir et al.
PloS one, 8(5), e61202-e61202 (2013-05-30)
Nutrient-deprivation autophagy factor-1 (NAF-1) (synonyms: Cisd2, Eris, Miner1, and Noxp70) is a [2Fe-2S] cluster protein immune-detected both in endoplasmic reticulum (ER) and mitochondrial outer membrane. It was implicated in human pathology (Wolfram Syndrome 2) and in BCL-2 mediated antagonization of
Ai-Gang Sun et al.
Molecular medicine reports, 16(6), 7939-7948 (2017-10-07)
CDGSH iron sulfur domain 2 (CISD2) has been found to be important in carcinogenesis. However, the role of CISD2 in glioma remains to be elucidated. The present study aimed to investigate the role of CISD2 in glioma using the reverse
Melanie A Jones et al.
Biology open, 3(5), 342-352 (2014-04-08)
Wolfram syndrome (WFS) is a progressive neurodegenerative disease characterized by diabetes insipidus, diabetes mellitus, optic atrophy, and deafness. WFS1 and WFS2 are caused by recessive mutations in the genes Wolfram Syndrome 1 (WFS1) and CDGSH iron sulfur domain 2 (CISD2)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service