Skip to Content
Merck
CN

AV45633

Anti-NR1H2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-LXR-b, Anti-LXRB, Anti-NER, Anti-NER-I, Anti-Nuclear receptor subfamily 1, group H, member 2, Anti-RIP15, Anti-UNR

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

mouse, horse, bovine, dog, rabbit, rat, human, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... NR1H2(7376)

Immunogen

Synthetic peptide directed towards the middle region of human NR1H2

Application

Anti-NR1H2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Biochem/physiol Actions

Nuclear receptor subfamily 1, group H, member 2 (NR1H2), also known as liver X receptor β (LXRB), is a nuclear receptor that forms heterodimers with retinoid X receptors to regulate gene expression. The members of LXR family are involved in inflammation, macrophage activation and lipid metabolism. Polymorphisms in NR1H2 are associated with preeclampsia, atherosclerosis and Alzheimer′s disease.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

12 - Non Combustible Liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



David H Volle et al.
Molecular and cellular endocrinology, 265-266, 183-189 (2007-01-09)
Various physiological functions have been ascribed to the liver X receptors (LXRs). Recently, we have identified new functions of these nuclear receptors in steroidogenic tissues. In adrenal, LXRalpha prevents accumulation of free cholesterol in mouse by controlling expression of genes
Mihir Parikh et al.
Journal of atherosclerosis and thrombosis, 21(6), 519-531 (2014-04-04)
The nuclear receptor liver X receptor [LXR] is activated by endogenous oxidized derivatives of cholesterol. It constitutes a critical receptor in the regulation of various physiological functions related to the development of metabolic and cardiovascular diseases, such as atherosclerosis and
Kevin Mouzat et al.
BMC medical genetics, 12, 145-145 (2011-10-28)
Preeclampsia is a frequent complication of pregnancy and a leading cause of perinatal mortality. Both genetic and environmental risk factors have been identified. Lipid metabolism, particularly cholesterol metabolism, is associated with this disease. Liver X receptors alpha (NR1H3, also known