Skip to Content
Merck
CN
Sign Into View Organizational & Contract Pricing

About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

40 kDa

species reactivity

canine, horse, mouse, human, guinea pig, bovine, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FCGRT(2217)

General description

Brambell receptor (FcRB, FcRn) is a neonatal Fc receptor that mediates transmission of immunity from mother to young perinatally across epithelial cells and plays a central role in IgG protection and homeostasis throughout life. Fc fragment of IgG, receptor, transporter, α (FCGRT) is the heavy (α) chain of FcRn an Fc receptor that structurally resembles the major histocompatibility complex class I molecule.

Specificity

Anti-FCGRT polyclonal antibody reacts with pig, human, mouse, bovine, and canine the α subunit of the neonatal receptor FcRn.

Immunogen

The immunogen for anti-FCGRT antibody: synthetic peptide derected towards the N terminal of human FCGRT

Application

Anti-FCGRT polyclonal antibody is used to tag Fc fragment of IgG, receptor, transporter, α protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of Fc fragment of IgG, receptor, transporter, α in the function of neonatal Fc receptor, FcRB.

Sequence

Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service