AV46818
Anti-NOX1 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-GP91-2, Anti-MOX1, Anti-NADPH oxidase 1, Anti-NOH-1, Anti-NOH1
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
65 kDa
species reactivity
mouse, pig, rat, bovine, zebrafish, rabbit, guinea pig, human, horse, canine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... NOX1(27035)
Immunogen
The immunogen for anti-NOX1 antibody: synthetic peptide derected towards the C terminal of human NOX1
Application
Anti-NOX1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.
Biochem/physiol Actions
NOX1 (NADPH oxidase 1) gene encodes for an enzyme that belongs to NADPH oxidase family and is expressed in the colon predominantly in differentiated epithelial cells. It plays a pivotal role in catalyzing the generation of the superoxide ion as well as requires two cytosolic regulators NOXA1 and NOXO1 and Rac1 for its activity. NOX1 is mitogenic and a potent trigger of the angiogenic switch, increasing the vascularity of tumors and inducing molecular markers of angiogenesis. Additionally, NOX1 and NOX2 stimulate neurotoxic activation of microglia suggesting that they play a crucial role during neuroinflammatory states and in amyotrophic lateral sclerosis (ALS).
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Biological roles for the NOX family NADPH oxidases.
William M Nauseef
The Journal of biological chemistry, 283(25), 16961-16965 (2008-04-19)
Jack L Arbiser et al.
Proceedings of the National Academy of Sciences of the United States of America, 99(2), 715-720 (2002-01-24)
The reactive oxygen-generating enzyme Nox1 transforms NIH 3T3 cells, rendering them highly tumorigenic and, as shown herein, also increases tumorigenicity of DU-145 prostate epithelial cells. Although Nox1 modestly stimulates cell division in both fibroblasts and epithelial cells, an increased mitogenic
Miklós Geiszt et al.
Journal of immunology (Baltimore, Md. : 1950), 171(1), 299-306 (2003-06-21)
Reactive oxygen species (ROS) serve several physiological functions; in some settings they act in host defense, while in others they function in cellular signaling or in biosynthetic reactions. We studied the expression and function of a recently described source of
Mykola V Tsapenko et al.
American journal of physiology. Renal physiology, 303(12), F1601-F1607 (2012-09-21)
Vascular access dysfunction causes morbidity in hemodialysis patients. This study examined the generation and pathobiological significance of superoxide anion in a rat femoral arteriovenous fistula (AVF). One week after AVF creation, there was increased production of superoxide anion accompanied by
Cyril Chéret et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 28(46), 12039-12051 (2008-11-14)
Reactive oxygen species (ROS) modulate intracellular signaling but are also responsible for neuronal damage in pathological states. Microglia, the resident CNS macrophages, are prominent sources of ROS through expression of the phagocyte oxidase which catalytic subunit Nox2 generates superoxide ion
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service