AV46947
Anti-PILRA antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-FDF03, Anti-Paired immunoglobin-like type 2 receptor α
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
18 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... PILRA(29992)
Immunogen
Synthetic peptide directed towards the N terminal region of human PILRA
Application
Anti-PILRA antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.
Biochem/physiol Actions
PILRA (Paired immunoglobin-like type 2 receptor alpha) gene encodes a single-pass type I membrane protein predominantily expressed in immune cells like monocytes, granulocytes and dendritic cells. PILR-associating neural protein (PANP) is a ligand for PILRA that facilitates the immune system regulation. It plays a pivotal role in regulating cell signaling via SHP-1 by balancing the PILRalpha-mediated inhibition and PILRbeta-mediated activation. Additionally, PILRalpha facilitates as a coreceptor that acquaints with glycoprotein B (gB) and assists in herpes simplex virus-1 entry. Further, it regulates the membrane fusion of the viral envelope with cellular membranes during virus entry and virus-induced cell-to-cell fusion.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Shigekazu Tabata et al.
Acta crystallographica. Section F, Structural biology and crystallization communications, 64(Pt 1), 44-46 (2007-12-22)
Human paired immunoglobulin-like (Ig-like) type 2 receptor alpha (PILRalpha) is a type I membrane protein that is mainly expressed in immune-related cells such as monocytes, granulocytes and dendritic cells. PILRalpha can suppress the functions of such immune cells because it
Takeshi Satoh et al.
Cell, 132(6), 935-944 (2008-03-25)
Glycoprotein B (gB) is one of the essential components for infection by herpes simplex virus-1 (HSV-1). Although several cellular receptors that associate with glycoprotein D (gD), such as herpes virus entry mediator (HVEM) and Nectin-1, have been identified, specific molecules
Amane Kogure et al.
Biochemical and biophysical research communications, 405(3), 428-433 (2011-01-19)
PILRα is an immune inhibitory receptor possessing an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic domain enabling it to deliver inhibitory signals. Binding of PILRα to its ligand CD99 is involved in immune regulation; however, whether there are other
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service