Skip to Content
Merck
CN

AV46947

Sigma-Aldrich

Anti-PILRA antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FDF03, Anti-Paired immunoglobin-like type 2 receptor α

Sign Into View Organizational & Contract Pricing

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

18 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PILRA(29992)

Immunogen

Synthetic peptide directed towards the N terminal region of human PILRA

Application

Anti-PILRA antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Biochem/physiol Actions

PILRA (Paired immunoglobin-like type 2 receptor alpha) gene encodes a single-pass type I membrane protein predominantily expressed in immune cells like monocytes, granulocytes and dendritic cells. PILR-associating neural protein (PANP) is a ligand for PILRA that facilitates the immune system regulation. It plays a pivotal role in regulating cell signaling via SHP-1 by balancing the PILRalpha-mediated inhibition and PILRbeta-mediated activation. Additionally, PILRalpha facilitates as a coreceptor that acquaints with glycoprotein B (gB) and assists in herpes simplex virus-1 entry. Further, it regulates the membrane fusion of the viral envelope with cellular membranes during virus entry and virus-induced cell-to-cell fusion.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Shigekazu Tabata et al.
Acta crystallographica. Section F, Structural biology and crystallization communications, 64(Pt 1), 44-46 (2007-12-22)
Human paired immunoglobulin-like (Ig-like) type 2 receptor alpha (PILRalpha) is a type I membrane protein that is mainly expressed in immune-related cells such as monocytes, granulocytes and dendritic cells. PILRalpha can suppress the functions of such immune cells because it
Takeshi Satoh et al.
Cell, 132(6), 935-944 (2008-03-25)
Glycoprotein B (gB) is one of the essential components for infection by herpes simplex virus-1 (HSV-1). Although several cellular receptors that associate with glycoprotein D (gD), such as herpes virus entry mediator (HVEM) and Nectin-1, have been identified, specific molecules
Amane Kogure et al.
Biochemical and biophysical research communications, 405(3), 428-433 (2011-01-19)
PILRα is an immune inhibitory receptor possessing an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic domain enabling it to deliver inhibitory signals. Binding of PILRα to its ligand CD99 is involved in immune regulation; however, whether there are other

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service