AV49147
Anti-PIGW antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-FLJ37433, Anti-Gwt1, Anti-Phosphatidylinositol glycan anchor biosynthesis, class W
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
57 kDa
species reactivity
horse, human, guinea pig, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... PIGW(284098)
Immunogen
Synthetic peptide directed towards the middle region of human PIGW
Application
Anti-PIGW antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
Phosphatidylinositol glycan anchor biosynthesis, class W (PIGW; Gwt1) mediates the acetylation of inositol ring of phosphatidylinositol during the biosynthesis of glycosylphosphatidylinositol (GPI). GPI acts as an anchor to cell surface proteins. Mutations in PIGW result in deficiency of GPI observed in West syndrome and hyperphosphatasia with mental retardation syndrome.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Tomohiro Chiyonobu et al.
Journal of medical genetics, 51(3), 203-207 (2013-12-25)
Glycosylphosphatidylinositol (GPI) is a glycolipid that anchors 150 or more kinds of proteins to the human cell surface. There are at least 26 genes involved in the biosynthesis and remodelling of GPI anchored proteins (GPI-APs). Recently, inherited GPI deficiencies (IGDs)
Mariko Umemura et al.
The Journal of biological chemistry, 278(26), 23639-23647 (2003-04-26)
Glycosylphosphatidylinositol (GPI) is a conserved post-translational modification to anchor cell surface proteins to plasma membrane in all eukaryotes. In yeast, GPI mediates cross-linking of cell wall mannoproteins to beta1,6-glucan. We reported previously that the GWT1 gene product is a target
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service