Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
western blot
Species reactivity:
horse, rat, guinea pig, dog, mouse, human
Citations:
7
Technique(s):
western blot: suitable
Uniprot accession no.:
Product Name
Anti-FAM20C (AB2) antibody produced in rabbit, affinity isolated antibody
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
66 kDa
species reactivity
horse, rat, guinea pig, dog, mouse, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... FAM20C(56975)
Application
Anti-FAM20C (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
FAM20C (Family with sequence similarity 20, member C) is a secretory Golgi casein kinase involved in biomineralization, enamel formation, lipid homeostasis, wound healing, cell migration and adhesion. It has ability to phosphorylate S-x-E/pS motifs on proteins present in milk and in the extracellular matrix of bones and teeth. During enamel formation, it forms a functional complex by binding to a pseudokinase, Fam20A, which triggers extracellular protein phosphorylation within the secretory pathway. Mutations in FAM20C gene cause Raine syndrome, hypophosphatemia, hyperphosphaturia, dental anomalies, intracerebral calcifications and osteosclerosis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
FAM20C (Family with sequence similarity 20, member C) is a member of FAM20 protein family. It is distributed in several mammalian cell lines. During hematopoietic differentiation, it is expressed in hematopoietic cells.
Immunogen
Synthetic peptide directed towards the C terminal region of human FAM20C
Other Notes
Synthetic peptide located within the following region: NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Nan Miao et al.
International journal of molecular medicine, 43(5), 2103-2117 (2019-03-14)
Family with sequence similarity 20‑member C (FAM20C), a recently characterized Golgi kinase, performs numerous biological functions by phosphorylating more than 100 secreted proteins. However, the role of FAM20C in the salivary glands remains undefined. The present study demonstrated that FAM20C is mainly
Hypophosphatemic osteomalacia and bone sclerosis caused by a novel homozygous mutation of the FAM20C gene in an elderly man with a mild variant of Raine syndrome.
Takeyari S, et al.
Bone, 67, 56-62 (2014)
Vincent S Tagliabracci et al.
Cell, 161(7), 1619-1632 (2015-06-20)
The existence of extracellular phosphoproteins has been acknowledged for over a century. However, research in this area has been undeveloped largely because the kinases that phosphorylate secreted proteins have escaped identification. Fam20C is a kinase that phosphorylates S-x-E/pS motifs on
Jixin Cui et al.
eLife, 4, e06120-e06120 (2015-03-20)
Although numerous extracellular phosphoproteins have been identified, the protein kinases within the secretory pathway have only recently been discovered, and their regulation is virtually unexplored. Fam20C is the physiological Golgi casein kinase, which phosphorylates many secreted proteins and is critical
Exome sequencing reveals FAM20c mutations associated with fibroblast growth factor 23-related hypophosphatemia, dental anomalies, and ectopic calcification.
Rafaelsen SH, et al.
Bone and Mineral, 28, 1378-1385 (2013)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service