biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
70 kDa
species reactivity
rat, mouse, human, rabbit, bovine, canine, horse
technique(s)
western blot: suitable
immunogen sequence
SAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPY
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... NTN4(59277)
Looking for similar products? Visit Product Comparison Guide
General description
The gene Netrin-4 (NTN4) is mapped to human chromosome 12q22-23. Netrins are a family of extracellular matrix proteins that show significant homology with laminins. NTN4 shows high expression in kidney, spleen, mammary gland, aorta, heart, ovary, prostate, and fetal spleen.
Immunogen
synthetic peptide corresponding to a region of human NTN4 with an internal ID of P29491
Application
Anti-NTN4 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of tissue sections at a concentration of 10μg/ml.
Biochem/physiol Actions
Netrin 4 (NTN4) regulates the embryonic development, promotes neurite growth and axonal elongation. NTN4 positively regulates thalamocortical axon brancing. The expression of NTN4 reportedly increases the resistance of glioblastoma cells to temozolomide and induces lymphangiogenesis by activating small GTPases and Src family kinases/FAK. NTN4 is down-regulated in cervical cancer tissues via miR-196a. NTN4 binds endothelial α6β1 integrin. This interaction regulates NTN4-induced cell adhesion, migration and focal adhesion contact.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
13 - Non Combustible Solids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Jie Zhang et al.
Biochemical and biophysical research communications, 440(4), 582-588 (2013-10-15)
Recent research has uncovered tumor-suppressive and oncogenic potential of miR-196a in various tumors. However, the expression and mechanism of its function in cervical cancer remains unclear. In this study, we assess relative expression of miR-196a in cervical premalignant lesions, cervical
Li Li et al.
PloS one, 8(11), e80363-e80363 (2013-11-23)
Glioblastoma multiforme is the most common primary tumor of the central nervous system. The drug temozolomide (TMZ) prolongs lifespan in many glioblastoma patients. The sensitivity of glioblastoma cells to TMZ is interfered by many factors, such as the expression of
Frederic Larrieu-Lahargue et al.
Circulation research, 109(7), 770-774 (2011-07-30)
Netrin-4 regulates vascular development. Identity of netrin-4 endothelial receptor and its subsequent cell functions is controversial. We previously demonstrated that the inhibition of netrin-1 canonical receptors, Unc5B and neogenin, expressed by lymphatic endothelial cells, do not suppress netrin-4-induced cell signaling
Frederic Larrieu-Lahargue et al.
Blood, 115(26), 5418-5426 (2010-04-22)
Netrin-4, a laminin-related secreted protein is an axon guidance cue recently shown essential outside of the nervous system, regulating mammary and lung morphogenesis as well as blood vascular development. Here, we show that Netrin-4, at physiologic doses, induces proliferation, migration
Yong N Li et al.
Experimental eye research, 96(1), 24-35 (2012-01-28)
Netrin-4, a member of the netrin family, is a potent regulator of embryonic development. It promotes neurite extension and regulates pulmonary airway branching, vasculogenesis patterning, and endothelial proliferation in pathological angiogenesis. The initial characterization of netrin-4 expression was focused on
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service