Skip to Content
Merck
CN

AV49645

Anti-NTN4 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym(s):

Anti-FLJ23180, Anti-Netrin 4, Anti-PRO3091

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

70 kDa

species reactivity

rat, mouse, human, rabbit, bovine, canine, horse

technique(s)

western blot: suitable

immunogen sequence

SAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPY

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... NTN4(59277)

Looking for similar products? Visit Product Comparison Guide

General description

The gene Netrin-4 (NTN4) is mapped to human chromosome 12q22-23. Netrins are a family of extracellular matrix proteins that show significant homology with laminins. NTN4 shows high expression in kidney, spleen, mammary gland, aorta, heart, ovary, prostate, and fetal spleen.

Immunogen

synthetic peptide corresponding to a region of human NTN4 with an internal ID of P29491

Application

Anti-NTN4 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of tissue sections at a concentration of 10μg/ml.

Biochem/physiol Actions

Netrin 4 (NTN4) regulates the embryonic development, promotes neurite growth and axonal elongation. NTN4 positively regulates thalamocortical axon brancing. The expression of NTN4 reportedly increases the resistance of glioblastoma cells to temozolomide and induces lymphangiogenesis by activating small GTPases and Src family kinases/FAK. NTN4 is down-regulated in cervical cancer tissues via miR-196a. NTN4 binds endothelial α6β1 integrin. This interaction regulates NTN4-induced cell adhesion, migration and focal adhesion contact.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

13 - Non Combustible Solids

wgk

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jie Zhang et al.
Biochemical and biophysical research communications, 440(4), 582-588 (2013-10-15)
Recent research has uncovered tumor-suppressive and oncogenic potential of miR-196a in various tumors. However, the expression and mechanism of its function in cervical cancer remains unclear. In this study, we assess relative expression of miR-196a in cervical premalignant lesions, cervical
Li Li et al.
PloS one, 8(11), e80363-e80363 (2013-11-23)
Glioblastoma multiforme is the most common primary tumor of the central nervous system. The drug temozolomide (TMZ) prolongs lifespan in many glioblastoma patients. The sensitivity of glioblastoma cells to TMZ is interfered by many factors, such as the expression of
Frederic Larrieu-Lahargue et al.
Circulation research, 109(7), 770-774 (2011-07-30)
Netrin-4 regulates vascular development. Identity of netrin-4 endothelial receptor and its subsequent cell functions is controversial. We previously demonstrated that the inhibition of netrin-1 canonical receptors, Unc5B and neogenin, expressed by lymphatic endothelial cells, do not suppress netrin-4-induced cell signaling
Frederic Larrieu-Lahargue et al.
Blood, 115(26), 5418-5426 (2010-04-22)
Netrin-4, a laminin-related secreted protein is an axon guidance cue recently shown essential outside of the nervous system, regulating mammary and lung morphogenesis as well as blood vascular development. Here, we show that Netrin-4, at physiologic doses, induces proliferation, migration
Yong N Li et al.
Experimental eye research, 96(1), 24-35 (2012-01-28)
Netrin-4, a member of the netrin family, is a potent regulator of embryonic development. It promotes neurite extension and regulates pulmonary airway branching, vasculogenesis patterning, and endothelial proliferation in pathological angiogenesis. The initial characterization of netrin-4 expression was focused on

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service