biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
61 kDa
species reactivity
mouse, guinea pig, horse, human, canine, rat, rabbit
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... CYP1B1(1545)
Immunogen
The immunogen for anti-CYP1B1 antibody: synthetic peptide derected towards the middle region of human CYP1B1
Application
Anti-CYP1B1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
Biochem/physiol Actions
Cytochrome P450, family 1, subfamily B, polypeptide 1 (CYP1B1) is a member of cytochrome P450 superfamily of monooxygenases. CYP1B1 is localized to the endoplasmic reticulum. It metabolizes polycyclic aromatic hydrocarbon and 17β-estradiol and is possibly involved in the metabolism of signaling molecule involved in the development of the eye. Mutations in CYP1B1 are associated with primary congenital glaucoma and congenital anterior staphylomas.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Xueli Chen et al.
The British journal of ophthalmology, 98(2), 246-251 (2013-11-15)
The aim of the present work was to investigate CYP1B1 gene mutations in patients of Han Chinese ethnicity with primary congenital glaucoma (PCG), and explore the clinical characteristics associated with operative effects. Peripheral blood genomic DNA was extracted from patients
Milana Kokosar et al.
Scientific reports, 6, 22883-22883 (2016-03-16)
Genetic and epigenetic factors may predispose women to polycystic ovary syndrome (PCOS), a common heritable disorder of unclear etiology. Here we investigated differences in genome-wide gene expression and DNA methylation in adipose tissue from 64 women with PCOS and 30
Ramzi Al Judaibi et al.
Clinical ophthalmology (Auckland, N.Z.), 8, 445-448 (2014-03-05)
Here, we present two patients with congenital anterior staphyloma, with mutations in the CYP1B1 gene. We reviewed the medical records, including the genetic analysis. Two unrelated patients presented with congenital anterior staphylomas. Both patients showed mutations in the CYP1B1 gene.
Douglas B Gould et al.
The International journal of developmental biology, 48(8-9), 1015-1029 (2004-11-24)
Development of the ocular anterior segment involves a series of inductive interactions between neural ectoderm, surface ectoderm and periocular mesenchyme. The timing of these events is well established but less is known about the molecular mechanisms involved. Various genes that
The nuclear vitamin D receptor: biological and molecular regulatory properties revealed.
M R Haussler et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 13(3), 325-349 (1998-04-03)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service