Skip to Content
Merck
CN

AV53702

Anti-FEM1B (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DKFZp451E0710, Anti-FIAA, Anti-Fem-1 homolog b (C. elegans)

Sign In to View Organizational & Contract Pricing.

Select a Size

About This Item

NACRES:
NA.41
UNSPSC Code:
12352203

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-FEM1B (AB1) antibody produced in rabbit, affinity isolated antibody

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

69 kDa

species reactivity

bovine, dog, horse, guinea pig, human, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_056137

UniProt accession no.

Q9UK73

shipped in

wet ice

storage temp.

−20°C

Quality Level

100

Gene Information

human ... FEM1B(10116)

Application

Anti-FEM1B (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

FEM1B [fem-1 homolog b (C. elegans)] gene encodes a protein which is a homolog of feminization-1 (FEM-1), a protein involved in the sex-determination pathway of the nematode Caenorhabditis elegans. It stimulates ubiquitylation of Gli1 as well as inhibits its transcriptional activity. It is a proapoptotic protein that facilitates proteasome inhibitor-induced apoptosis of human colon cancer cells. Additionally, FEM1B serves as an adapter or mediator protein that links CHK1 and Rad9 and facilitates checkpoint signaling induced by replication stress.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human FEM1B

Other Notes

Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC21890

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Andrew S Gilder et al.
Biochemical and biophysical research communications, 440(3), 431-436 (2013-10-01)
The mammalian Fem1b gene encodes a homolog of FEM-1, a protein in the sex-determination pathway of the nematode Caenorhabditis elegans. Fem1b and FEM-1 proteins each contain a VHL-box motif that mediates their interaction with certain E3 ubiquitin ligase complexes. In
M Cecilia Subauste et al.
Molecular carcinogenesis, 49(2), 105-113 (2009-11-13)
In the treatment of colon cancer, the development of resistance to apoptosis is a major factor in resistance to therapy. New molecular approaches to overcome apoptosis resistance, such as selectively upregulating proapoptotic proteins, are needed in colon cancer therapy. In
T-P Sun et al.
Oncogene, 28(18), 1971-1981 (2009-03-31)
Human checkpoint kinase 1 (CHK1) is an essential kinase required to preserve genome stability, and is activated by DNA replication blockage through the ataxia-telangiectasia-mutated-and-Rad3-related (ATR)/ATRIP-signaling pathway. In this report, we show that a novel CHK1-interacting protein, FEM1B (human homologue of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service