Skip to Content
Merck
CN

AV54322

Anti-IL1A antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym(s):

Anti-IL-1A, Anti-IL1, Anti-IL1-ALPHA, Anti-IL1F1, Anti-Interleukin 1, α

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

18 kDa

species reactivity

bovine, human, mouse, horse

technique(s)

western blot: suitable

immunogen sequence

YHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRR

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... IL1A(3552)

Immunogen

synthetic peptide corresponding to a region of human IL1A with an internal ID of P31070

Application

Anti-IL1A antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

Interleukins are proinflammatory cytokines produced on cell injury or trauma. There are two closely related types of interleukins produced by the cell, IL-1α and IL-1β that are produced by the activation of NF-κB transcription factor in response to bacterial infection or LPS. Both IL-1α and IL-1β exert their cellular effects by signalling through IL-1 receptor type 1. A variety of cells such as macrophages, epithelial cells, fibroblasts, keratinocytes, monocytes and dendritic cells secrete IL-1α. Both IL-1α and IL-1β are important in acquired immunity, inflammation, response to infection and production of matrix metalloproteinases (MMPs). The effects of IL-1α are mediated by activation of NF-κB, JNK and MAPK pathways that activated the genes in response to infection and inflammation. Overproduction of IL-1α has been implicated in inflammatory disorders like rheumatoid arthritis and periodontitis.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

13 - Non Combustible Solids

wgk

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Fan Yang et al.
Molecular medicine reports, 12(4), 6199-6206 (2015-08-05)
Polymorphisms located at microRNA (miRNA) binding sites may affect the expression of genes. The present study aimed to identify the association between an insertion/deletion (Ins/Del) polymorphism (rs3783553) in the 3'‑untranslated region (3'‑UTR) of interleukin‑1α (IL‑1A) and the risk for osteoarthritis
S Z Ben-Sasson et al.
Cytokine, 56(1), 122-125 (2011-08-17)
IL-1 strikingly enhances antigen-driven responses of CD4 and CD8 T cells. It is substantially more effective than LPS and when added to a priming regime of antigen plus LPS, it strikingly enhances cell expansion. The effect is mediated by direct
H E Barksby et al.
Clinical and experimental immunology, 149(2), 217-225 (2007-06-26)
Understanding cytokine immunobiology is central to the development of rational therapies for destructive inflammatory diseases such as rheumatoid arthritis (RA) and periodontitis. The classical interleukin-1 (IL-1) family cytokines, IL-1alpha and IL-1beta, as well as IL-18, play key roles in inflammation.
Charles A Dinarello
Current opinion in pharmacology, 4(4), 378-385 (2004-07-15)
All biological agents currently used for reducing TNFalpha activity in disease are neutralization strategies; however, there are several strategies for reducing interleukin (IL)-1 activities: the IL-1 receptor antagonist (IL-1Ra), anti-IL-1beta monoclonal antibodies, the IL-1 Trap, IL-1 receptor type I antibodies
Axel Weber et al.
Science signaling, 3(105), cm1-cm1 (2010-01-21)
The interleukin-1 (IL-1) family of cytokines comprises 11 proteins (IL-1F1 to IL-1F11) encoded by 11 distinct genes in humans and mice. IL-1-type cytokines are major mediators of innate immune reactions, and blockade of the founding members IL-1alpha or IL-1beta by

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service