AV54322
Anti-IL1A antibody produced in rabbit
affinity isolated antibody, lyophilized powder
Synonym(s):
Anti-IL-1A, Anti-IL1, Anti-IL1-ALPHA, Anti-IL1F1, Anti-Interleukin 1, α
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
18 kDa
species reactivity
bovine, human, mouse, horse
technique(s)
western blot: suitable
immunogen sequence
YHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRR
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... IL1A(3552)
Immunogen
synthetic peptide corresponding to a region of human IL1A with an internal ID of P31070
Application
Anti-IL1A antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
Interleukins are proinflammatory cytokines produced on cell injury or trauma. There are two closely related types of interleukins produced by the cell, IL-1α and IL-1β that are produced by the activation of NF-κB transcription factor in response to bacterial infection or LPS. Both IL-1α and IL-1β exert their cellular effects by signalling through IL-1 receptor type 1. A variety of cells such as macrophages, epithelial cells, fibroblasts, keratinocytes, monocytes and dendritic cells secrete IL-1α. Both IL-1α and IL-1β are important in acquired immunity, inflammation, response to infection and production of matrix metalloproteinases (MMPs). The effects of IL-1α are mediated by activation of NF-κB, JNK and MAPK pathways that activated the genes in response to infection and inflammation. Overproduction of IL-1α has been implicated in inflammatory disorders like rheumatoid arthritis and periodontitis.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
13 - Non Combustible Solids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Fan Yang et al.
Molecular medicine reports, 12(4), 6199-6206 (2015-08-05)
Polymorphisms located at microRNA (miRNA) binding sites may affect the expression of genes. The present study aimed to identify the association between an insertion/deletion (Ins/Del) polymorphism (rs3783553) in the 3'‑untranslated region (3'‑UTR) of interleukin‑1α (IL‑1A) and the risk for osteoarthritis
S Z Ben-Sasson et al.
Cytokine, 56(1), 122-125 (2011-08-17)
IL-1 strikingly enhances antigen-driven responses of CD4 and CD8 T cells. It is substantially more effective than LPS and when added to a priming regime of antigen plus LPS, it strikingly enhances cell expansion. The effect is mediated by direct
H E Barksby et al.
Clinical and experimental immunology, 149(2), 217-225 (2007-06-26)
Understanding cytokine immunobiology is central to the development of rational therapies for destructive inflammatory diseases such as rheumatoid arthritis (RA) and periodontitis. The classical interleukin-1 (IL-1) family cytokines, IL-1alpha and IL-1beta, as well as IL-18, play key roles in inflammation.
Charles A Dinarello
Current opinion in pharmacology, 4(4), 378-385 (2004-07-15)
All biological agents currently used for reducing TNFalpha activity in disease are neutralization strategies; however, there are several strategies for reducing interleukin (IL)-1 activities: the IL-1 receptor antagonist (IL-1Ra), anti-IL-1beta monoclonal antibodies, the IL-1 Trap, IL-1 receptor type I antibodies
Axel Weber et al.
Science signaling, 3(105), cm1-cm1 (2010-01-21)
The interleukin-1 (IL-1) family of cytokines comprises 11 proteins (IL-1F1 to IL-1F11) encoded by 11 distinct genes in humans and mice. IL-1-type cytokines are major mediators of innate immune reactions, and blockade of the founding members IL-1alpha or IL-1beta by
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service