AV54435
Anti-C5ORF39 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-AX2R, Anti-AXIIR
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
22 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... C5orf39(389289)
Immunogen
Synthetic peptide directed towards the N terminal region of human C5orf39
Application
Anti-C5ORF39 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
C5ORF39 or AX2R (annexin A2 receptor) gene encodes a cell surface receptor for annexin II. It is predominantly expressed in lymphocytes, in both resting CD4+ and CD8+ T-cell. AX2R is located in cytoplasm where it binds to and stimulates pro-caspase-8 followed by caspase-3/7. Hence, AX2R induces apoptosis independent of annexin II and FADD. Annexin II binds to AXIIR and enhances the multiple myeloma cell adhesion and growth in the bone marrow microenvironment. Additionally, annexin II and its receptor AXIIR regulates adhesion, migration, homing, and growth of prostate cancer.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Yusuke Shiozawa et al.
Journal of cellular biochemistry, 105(2), 370-380 (2008-07-19)
One of the most life-threatening complications of prostate cancer is skeletal metastasis. In order to develop treatment for metastasis, it is important to understand its molecular mechanisms. Our work in this field has drawn parallels between hematopoietic stem cell and
Sonia D'Souza et al.
Blood, 119(8), 1888-1896 (2012-01-10)
Multiple myeloma (MM) is an incurable B-cell malignancy in which the marrow microenvironment plays a critical role in our inability to cure MM. Marrow stromal cells in the microenvironment support homing, lodging, and growth of MM cells through activation of
Yuan Xiong et al.
Apoptosis : an international journal on programmed cell death, 18(8), 925-939 (2013-05-04)
Annexin II receptor (AXIIR) is also known as chromosome 5 open reading frame 39 (C5orf39), it was originally identified as a cell surface receptor for Annexin II. AXIIR gene is peculiar to human. So far, the only known function about
Ganwei Lu et al.
The Journal of biological chemistry, 281(41), 30542-30550 (2006-08-10)
Annexin II is a heterotetramer, consisting of two 11-kDa (p11) and two 36-kDa (p36) subunits, that is produced by osteoclasts and stimulates osteoclast formation. However, its receptor is unknown. We showed that annexin II binds to normal primary human marrow
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service