Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
56 kDa
species reactivity
human, horse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... CCDC7(221016)
Immunogen
Synthetic peptide directed towards the N terminal region of human CCDC7
Application
Anti-CCDC7 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
CCDC7 (Coiled-Coil domain containing 7) or BioT2-A(BioT2-B,BioT2-C) gene is located on chromosome 10 and is widely expressed in epithelium of normal cervix and cervical cancer. It may play a role in inducing carcinogenesis in endometrial cancer. Overexpression of hBiot2 gene results in early and interim development of human cervical cancer.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Shen Yangmei et al.
Acta obstetricia et gynecologica Scandinavica, 86(12), 1503-1509 (2007-11-21)
Rat Biot2 is a novel gene first reported and named by our laboratory. We wanted to study the expression profile and reveal the function of its human homologous gene (human Biot2, hBiot2) on carcinogenesis in endometrial cancer. Using RT-PCR, we
Yang-Mei Shen et al.
Oncology reports, 25(1), 75-80 (2010-11-27)
The novel gene human Biot2 (hBiot2) was first reported by our laboratory. Previously, we indicated its function of proliferation and carcinogenesis in human endometrial cancer. In the present study, we aimed to investigate whether hBiot2 played a similar role in
P Deloukas et al.
Nature, 429(6990), 375-381 (2004-05-28)
The finished sequence of human chromosome 10 comprises a total of 131,666,441 base pairs. It represents 99.4% of the euchromatic DNA and includes one megabase of heterochromatic sequence within the pericentromeric region of the short and long arm of the