Skip to Content
Merck
CN

AV54463

Anti-CCDC7 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BioT2-A, Anti-BioT2-B, Anti-BioT2-C, Anti-Coiled-Coil domain containing 7, Anti-DKFZp686N0559, Anti-FLJ32762, Anti-RP11-479G22.1

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

human, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CCDC7(221016)

Immunogen

Synthetic peptide directed towards the N terminal region of human CCDC7

Application

Anti-CCDC7 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

CCDC7 (Coiled-Coil domain containing 7) or BioT2-A(BioT2-B,BioT2-C) gene is located on chromosome 10 and is widely expressed in epithelium of normal cervix and cervical cancer. It may play a role in inducing carcinogenesis in endometrial cancer. Overexpression of hBiot2 gene results in early and interim development of human cervical cancer.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

12 - Non Combustible Liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Shen Yangmei et al.
Acta obstetricia et gynecologica Scandinavica, 86(12), 1503-1509 (2007-11-21)
Rat Biot2 is a novel gene first reported and named by our laboratory. We wanted to study the expression profile and reveal the function of its human homologous gene (human Biot2, hBiot2) on carcinogenesis in endometrial cancer. Using RT-PCR, we
Yang-Mei Shen et al.
Oncology reports, 25(1), 75-80 (2010-11-27)
The novel gene human Biot2 (hBiot2) was first reported by our laboratory. Previously, we indicated its function of proliferation and carcinogenesis in human endometrial cancer. In the present study, we aimed to investigate whether hBiot2 played a similar role in
P Deloukas et al.
Nature, 429(6990), 375-381 (2004-05-28)
The finished sequence of human chromosome 10 comprises a total of 131,666,441 base pairs. It represents 99.4% of the euchromatic DNA and includes one megabase of heterochromatic sequence within the pericentromeric region of the short and long arm of the