AV54532
Anti-PELI3 (AB1) antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-MGC35521, Anti-Pellino homolog 3 (Drosophila)
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
48 kDa
species reactivity
human, pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PELI3(246330)
Immunogen
Synthetic peptide directed towards the N terminal region of human PELI3
Application
Anti-PELI3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
The gene PELI3 encodes a scaffold protein involved in TLR (Toll-like receptor)/IL-1R (IL-1 receptor) signalling pathways that shape innante immunity via interaction with the complex containing IRAK kinases and TRAF6. This leads to nuclear factor-κB and mitogen activated protein kinase-dependent gene expression. The pellino protein also induces IRAK-1 polyubiquitination in a RING-dependent manner, which in turn regulates TLR/IL-1R signalling. Pellino3 targets the interferon regulatory factor 7 pathway and facilitates autoregulation of toll-like receptors (TLR3)- and viral-induced expression of type I interferons.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Reinout Schauvliege et al.
FEBS letters, 580(19), 4697-4702 (2006-08-04)
Members of the Toll-like receptor (TLR) and IL-1 receptor (IL-1R) family initiate signalling pathways that shape innate immunity. Pellino proteins have recently been implicated as evolutionary conserved scaffold proteins in TLR/IL-1R signalling leading to nuclear factor-kappaB and mitogen activated protein
Jakub Siednienko et al.
Nature immunology, 13(11), 1055-1062 (2012-10-09)
Toll-like receptors (TLRs) sense pathogen-associated molecules and respond by inducing cytokines and type I interferon. Here we show that genetic ablation of the E3 ubiquitin ligase Pellino3 augmented the expression of type I interferon but not of proinflammatory cytokines in
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service