Skip to Content

HPA003239

Anti-PCMT1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

enhanced validation

Enhanced Validation

Synonym(s):

Anti-L-Isoaspartyl protein carboxyl methyltransferase antibody produced in rabbit, Anti-PIMT antibody produced in rabbit, Anti-Protein L-isoaspartyl/D-aspartyl methyltransferase antibody produced in rabbit, Anti-Protein-β-aspartate methyltransferase antibody produced in rabbit, Anti-Protein-L-isoaspartate(D-aspartate) O-methyltransferase antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
7
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Segment

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, mouse, human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PCMT1(5110)

General description

PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase) gene encodes a protein that belongs to type II class of protein carboxyl methyltransferase enzymes. This gene is mapped to human chromosome 6q24-25.

Immunogen

Protein-L-isoaspartate(D-aspartate) O-methyltransferase recombinant protein epitope signature tag (PrEST)

Application

Anti-PCMT1 antibody produced in rabbit is suitable for use in proteome-wide epitope mapping covering all human proteins for on- and off-target binding analysis.
Anti-PCMT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase) protein repairs modified proteins by catalyzing the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that are formed from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It negatively regulates p53, a tumour suppressor protein, and in turn downregulates p53-mediated transcription of target genes. It may serve as a therapeutic target for cancers. It protects neural cells from Bax-induced apoptosis and defects in this gene may cause spina bifida in infants. It activates integrin αv and mediates cell adhesion in various cancer cell lines. The protein negatively regulates β−amyloid peptide formation and plays a protective role in Alzheimer′s disease pathogenesis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST79907

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library