Skip to Content
Merck
CN

HPA006367

Anti-PCYT1B antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CCT B antibody produced in rabbit, Anti-CCT-β antibody produced in rabbit, Anti-CT B antibody produced in rabbit, Anti-CTP:phosphocholine cytidylyltransferase B antibody produced in rabbit, Anti-Choline-phosphate cytidylyltransferase B antibody produced in rabbit, Anti-Phosphorylcholine transferase B antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
3
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

PVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PCYT1B(9468)

General description

PCYT1B (phosphate cytidylyltransferase 1, choline β), is the second isoform of the enzyme CTP:phosphocholine cytidylyltransferase (CCT). The other isoform of this enzyme is CCTα. PCYT1B transcripts are present in both human adult and fetal tissues. It has a predominant expression in testis and placenta. Its catalytic domain is highly similar to that of CCTα, which is succeeded by three amphipathic helical repeats. This protein is localized to the cytosol.

Immunogen

Choline-phosphate cytidylyltransferase B recombinant protein epitope signature tag (PrEST)

Application

Anti-PCYT1B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PCYT1B (phosphate cytidylyltransferase 1, choline β) plays an essential role in the control of phosphatidylcholine biosynthesis. Phosphatidylcholine is an essential component of human kidney stones, and negatively controls lithiasis. It also suppresses the growth of calcium oxalate (CaOx) crystal.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74362

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

新产品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Victoria A Acosta-Rodríguez et al.
Journal of lipid research, 54(7), 1798-1811 (2013-05-04)
Circadian clocks regulate the temporal organization of several biochemical processes, including lipid metabolism, and their disruption leads to severe metabolic disorders. Immortalized cell lines acting as circadian clocks display daily variations in [(32)P]phospholipid labeling; however, the regulation of glycerophospholipid (GPL)
A Lykidis et al.
The Journal of biological chemistry, 273(22), 14022-14029 (1998-06-05)
CTP:phosphocholine cytidylyltransferase (CCT) is a key regulator of phosphatidylcholine biosynthesis, and only a single isoform of this enzyme, CCTalpha, is known. We identified and sequenced a human cDNA that encoded a distinct CCT isoform, called CCTbeta, that is derived from
Priyadarshini et al.
Clinica chimica acta; international journal of clinical chemistry, 408(1-2), 34-38 (2009-07-15)
A relatively small number of well-characterized inhibitors of kidney stone formation have been identified from the previous research involved in its formation. In this study conventional biochemical methods have been combined with recent advances in mass spectrometry (MS) to identify



Global Trade Item Number

SKUGTIN
HPA006367-25UL04061842776962
HPA006367-100UL04061837136436