Skip to Content
Merck
CN

HPA007179

Sigma-Aldrich

Anti-PTPRN antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ICA 512 antibody produced in rabbit, Anti-Islet cell antigen 512 antibody produced in rabbit, Anti-Islet cell autoantigen 3 antibody produced in rabbit, Anti-PTP IA-2 antibody produced in rabbit, Anti-R-PTP-N antibody produced in rabbit, Anti-Receptor-type tyrosine-protein phosphatase-like N precursor antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA007179
NACRES:
NA.43

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA

UniProt accession no.

Q16849

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PTPRN(5798)

Related Categories

General description

The insulinoma associated protein tyrosine phosphatase 2 (IA-2)/ PTPRN is a transmembrane glycoprotein of 106 kDa. Its expression is seen in neuroendocrine cells. IA-2 is a member of the protein tyrosine phosphatase (PTP) family. It has three domains, such as the extracellular domain, intracellular domain and a single transmembrane domain. This gene is mapped to human chromosome 2q35.

Immunogen

Receptor-type tyrosine-protein phosphatase-like N precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-PTPRN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PTPRN (Protein tyrosine phosphatase, receptor type, N) is involved in the neuroendocrine secretory processes such as biogenesis, trafficking or regulated exocytosis. A study shows that PTPRN is associated with the type 1 diabetes development.
The insulinoma associated protein tyrosine phosphatase 2 (IA-2)/PTPRN is an immunodominant autoantigen, that participates in the autoimmune attack to the β-cell in type 1 diabetes mellitus. It plays a key role in the cytoplasmic transport of dense core secretory granules (DSG) in pancreatic islets.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70124

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
A40086
R04306
R004306

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Assignment of the human gene for receptor-type protein tyrosine phosphatase IA-2 (PTPRN) to chromosome region 2q35-q36.1 and identification of an intragenic genetic marker
van den MAMJM, et al.
Cytogenetic and genome research, 73(1-2), 145-148 (1996)
William J Giardino et al.
Frontiers in neuroanatomy, 6, 5-5 (2012-02-22)
Detailed examination of the midbrain Edinger-Westphal (EW) nucleus revealed the existence of two distinct nuclei. One population of EW preganglionic (EWpg) neurons was found to control oculomotor functions, and a separate population of EW centrally projecting (EWcp) neurons was found
Novel prokaryotic expression of thioredoxin-fused insulinoma associated protein tyrosine phosphatase 2 (IA-2), its characterization and immunodiagnostic application
Guerra LL, et al.
BMC biotechnology, 16, 84-84 (2016)
Stephanie Krause et al.
Clinical immunology (Orlando, Fla.), 145(3), 224-229 (2012-11-01)
Autoantibodies to insulinoma-associated protein 2 (IA-2A) are associated with increased risk for type 1 diabetes. Here we examined IA-2A affinity and epitope specificity to assess heterogeneity in response intensity in relation to pathogenesis and diabetes risk in 50 children who
María E Primo et al.
PloS one, 6(9), e24191-e24191 (2011-09-22)
ICA512 (or IA-2) is a transmembrane protein-tyrosine phosphatase located in secretory granules of neuroendocrine cells. Initially, it was identified as one of the main antigens of autoimmune diabetes. Later, it was found that during insulin secretion, the cytoplasmic domain of
View All Related Papers

Articles

Glioma Markers for High-Grade Gliomas and Low-Grade Gliomas

Learn about glioma markers for high-grade gliomas and low-grade gliomas and find reliable Prestige Antibodies® to target glioma markers.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service