Skip to Content
Merck
CN

HPA010122

Anti-DLG4 Antibody

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

enhanced validation

Enhanced Validation

Synonym(s):

Anti-Disks large homolog 4, Anti-PSD-95, Anti-Postsynaptic density protein 95, Anti-SAP90, Anti-Synapse-associated protein 90

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
6
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


Product Name

Anti-DLG4 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

Quality Segment

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DLG4(1742)

General description

DLG4 (discs large homolog 4) gene is localized to human chromosome 17p13.1. It is an abundantly present scaffolding protein. It is a multi-domain protein, which is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. This protein family is characterized by PSD-95/discs large/ZO-1 (PDZ)-Src homology 3 (SH3)-guanylate kinase domain. DLG4 is localized to the cytoplasmic ends of postsynaptic terminals.

Immunogen

Disks large homolog 4 recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Biochem/physiol Actions

Knockout (KO) mice for DLG4 (discs large homolog 4) are characterized by aberrant synaptic plasticity and impaired spatial learning. Polymorphisms in this gene at the core promoter region and the 3′ and 5′ UTR (untranslated regions) control its expression, which in turn is associated with susceptibility to schizophrenia. It couples the activity of N-methyl-D-aspartate receptors (NMDARs) to neurotoxicity by NO (nitric oxide), and is also responsible for specificity to excitotoxic Ca2+ signaling. This protein functions in the postsynapse at excitatory neurons, where it is responsible for the clustering of glutamate receptors and organization of macromolecular complexes for signal integration. In Alzheimer′s diseases, an increase in the expression of this protein is linked with increase in β-amyloid and phosphorylated Tau proteins.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71165

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

— or —

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library