Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
4
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:20- 1:50
immunogen sequence
NEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDF
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GLIPR1(11010)
General description
Glioma pathogenesis-related protein 1 (GLIPR1) is a multifunctional protein which was first recognized in human glioblastomas. It resides in endoplasmic reticulum (ER) and vesicles in cytoplasm. It is a transmembrane protein with its C-terminal spanning the membrane, and has a signal peptide at its N-terminal. It belongs to the CAP (cysteine-rich secretory proteins, antigen 5 and pathogenesis-related 1 proteins) family of proteins, and thus, contains the cysteine-rich CAP domain. GLIPR1 exists as three isoforms, namely, GLIPR1, GLIPR1-like 1 (GLIPR1L1) and GLIPR1-like 2 (GLIPR1L2). GLIPR1 and GLIPR1L2 have a wide range of tissue expression, whereas GLIPR1L1 is predominantly expressed in testis.
Immunogen
Glioma pathogenesis-related protein 1 precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Glioma pathogenesis-related protein 1 (GLIPR1) is involved in cell cycle, tumorigenesis and apoptosis. It acts as an oncogene in glioblastoma and gliomas, and is overexpressed in the same. It is also unregulated in acute myeloid leukemia (AML), and may facilitate the proliferation of AML cells. Its expression levels are positively correlated with metastasis of tumors in case of astrocytic brain malignancies. Studies suggest that GLIPR1 acts as a tumor suppressor gene in prostate cancer, and its expression is suppressed in prostate cancer cells as compared to normal prostate cells. The expression of this gene is induced by the tumor suppressor gene p53 as well as DNA damage-causing substances such as irradiation. It is an HIV-1 dependency factor (HDF), and it is overexpressed during initial stages of HIV-1 (human immunodeficiency virus-1) infection.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71999
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-GLIPR1 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Gianni Capalbo et al.
Oncology reports, 30(5), 2254-2262 (2013-09-07)
Glioma pathogenesis‑related protein 1 (GliPR1) is a pleiotropic protein involved in cell proliferation, tumor growth and apoptosis. The aim of the present study was to further characterize GliPR1 in regard to its subcellular localization and its overall effect on cellular
Yan-Hua Xiao et al.
Journal of cancer research and clinical oncology, 137(12), 1831-1840 (2011-09-17)
To identify methylation-silenced genes in acute myeloid leukemia (AML). Microarray analyses were performed in AML cell line HL-60 cells exposed to the demethylating agent 5-aza-2dC. The methylation status and expression of glioma pathogenesis-related protein 1 (GLIPR1), one of highly induced
Oluwatoyin A Asojo et al.
Acta crystallographica. Section D, Biological crystallography, 67(Pt 10), 847-855 (2011-09-21)
Human glioma pathogenesis-related protein 1 (GLIPR1) is a membrane protein that is highly upregulated in brain cancers but is barely detectable in normal brain tissue. GLIPR1 is composed of a signal peptide that directs its secretion, a conserved cysteine-rich CAP
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA011014-25UL | 04061842817306 |
| HPA011014-100UL | 04061836320317 |