Skip to Content
Merck
CN

HPA015028

Anti-SLC6A6 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

Anti-Sodium- and chloride-dependent taurine transporter, Anti-Solute carrier family 6 member 6

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

ATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGIDHP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SLC6A6(6533)

Looking for similar products? Visit Product Comparison Guide

General description

SLC6A6 (solute carrier family 6, member 6) is also named taurine transporter (TauT), and is a Na+-dependent β amino acid transporter. It is expressed on microvillous plasma membrane of syncytiotrophoblast, which is a part of human placenta. This transporter contains twelve transmembrane domains (TMD), and its extracellular loop between third and fourth TMD contains two/three N-glycoslyation sites, and the loop between TMDs eleventh and twelfth contains the fourth N-glycosylation site. It has a molecular weight of 65-74kDa.

Immunogen

Sodium- and chloride-dependent taurine transporter recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SLC6A6 (solute carrier family 6, member 6), also called taurine transporter (TauT) facilitates the transport of taurine, in human placenta, which is required for normal turnover of trophoblast. Taurine is essential for the survival and differentiation of trophoblast cells, as well as the development of fetal brain, retina, heart, pancreas, kidney and skeletal muscles. In pregnancies with pre-eclampsia and maternal obesity, SLC6A6 is suppressed leading to fetal growth restriction and aberrant renewal of syncytiotrophoblast. The expression of this protein is influenced by changes in diet, DNA damage, oxidative stress and cell tonicity. Studies on human embryonic kidney (HEK)293 cell line show that inactivation of this gene hinders normal renal cell development.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73284.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

C El-Chami et al.
The British journal of dermatology, 184(3), 482-494 (2020-04-30)
The epidermal barrier is important for water conservation, failure of which is evident in dry-skin conditions. Barrier function is fulfilled by the stratum corneum, tight junctions (TJs, which control extracellular water) and keratinocyte mechanisms, such as organic osmolyte transport, which
Xiaobin Han et al.
Advances in experimental medicine and biology, 776, 307-320 (2013-02-09)
Studies have demonstrated that TauT deficiency results in small kidneys in TauT knockout mice. Our studies have shown that TauT is a direct target of several genes, including p53 and WT1, which play an important role in renal development. However
C G Iruloh et al.
American journal of physiology. Cell physiology, 292(1), C332-C341 (2006-09-08)
Transplacental transfer of taurine, a beta-amino acid essential for fetal and neonatal development, constitutes the primary source of taurine for the fetus. Placental transport of taurine is compromised in pregnancies complicated by intrauterine growth restriction, resulting in a reduced concentration
April R Foster et al.
Aging cell, 19(1), e13058-e13058 (2019-11-27)
Aging is characterized by the deterioration of tissue structure and function. In skin, environmental factors, for example, ultraviolet radiation (UVR), can accelerate the effects of aging such as decline in barrier function and subsequent loss of hydration. Water homeostasis is
Michelle Desforges et al.
Advances in experimental medicine and biology, 776, 81-91 (2013-02-09)
Taurine is an important nutrient in intrauterine life, being required for fetal organ development and cellular renewal of syncytiotrophoblast (STB), the nutrient transport epithelium of the placenta. As taurine is conditionally essential in human pregnancy, the fetal and placental demand

Articles

Protein-based drug transporters are expressed in Sf9 cells. Understanding the specific mechanisms of tumor cell transporters is an essential aspect of chemotherapeutic drug design.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service