Skip to Content
Merck
CN

HPA015315

Anti-WHSC1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Multiple myeloma SET domain-containing protein, Anti-Nuclear SET domain-containing protein 2, Anti-Probable histone-lysine N-methyltransferase NSD2, Anti-Protein trithorax-5, Anti-Wolf-Hirschhorn syndrome candidate 1 protein

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, indirect immunofluorescence: suitable, western blot: suitable

immunogen sequence

QAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSA

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... WHSC1(7468)

General description

WHSC1 (Wolf-Hirschhorn syndrome candidate 1) is an oncogene belonging to the SET domain containing NSD (nuclear receptor binding SET domain) protein family. It produces several different isoforms, with the predominant being MMSETII (Multiple Myeloma SET Domain), which resides in the nucleus. Another common isoform is called REIIBP (interleukin-5 [IL-5] response element II binding protein), which is localized to cytoplasm and nucleus both. This gene also codes for highly expressed ACA11, which is a small nucleolar RNA (snoRNA). This gene is composed of 24 exons, spans 120kb, and codes for 1365 amino acid MMSETII.

Immunogen

Probable histone-lysine N-methyltransferase NSD2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

WHSC1 (Wolf-Hirschhorn syndrome candidate 1) is involved in the regulation of apoptosis, cell cycle and cell adhesion. It is involved in the dimethylation of H3K36, and MMSETII is involved in the histone methylation of H3K4, H3K27, H3K36 and H4K20. This functionality of this protein is mediated through its SET domain. Chromosomal translocation t(4;14) of this gene is implicated in multiple myeloma (MM), and correlates with poor prognosis. In gastric cancer, the mRNA levels of WHSC1 are related to the response to first-line FOLFOX (Folinic acid, Fluorouracil (5-FU), Oxaliplatin) and second-line docetaxel therapy. Therefore, this gene can be used to determine chemotherapy in gastric cancer cases.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73692.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

12 - Non Combustible Liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library


Related Content

Prestige Antibodies Immunofluorescence Procedure


J Wei et al.
British journal of cancer, 110(11), 2662-2668 (2014-05-09)
Breast cancer susceptibility gene 1 (BRCA1) expression differentially affects outcome to platinum- and taxane-based chemotherapy. Mediator of DNA damage checkpoint protein 1 (MDC1), p53-binding protein 1 (53BP1), multiple myeloma SET domain (MMSET) and ubiquitin-conjugating enzyme 9 (UBC9) are involved in
Zhigang Xie et al.
Oncotarget, 4(7), 1008-1018 (2013-08-01)
Multiple myeloma (MM) is characterized by recurrent chromosomal translocations. MMSET, identified by its fusion to the IgH locus in t(4;14) MM, is universally overexpressed in t(4;14) MM. In order to identify cell surface biomarkers associated with t(4;14) MM for small
Fabio Mirabella et al.
PloS one, 9(6), e99493-e99493 (2014-06-14)
The chromosomal translocation t(4;14) deregulates MMSET (WHSC1/NSD2) expression and is a poor prognostic factor in multiple myeloma (MM). MMSET encodes two major protein isoforms. We have characterized the role of the shorter isoform (REIIBP) in myeloma cells and identified a