Skip to Content
Merck
CN

HPA018303

Anti-OLIG3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Class B basic helix-loop-helix protein 7, Anti-Oligo3, Anti-Oligodendrocyte transcription factor 3, Anti-bHLHB7

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
MDL number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
8
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20-1:50

immunogen sequence

NSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... OLIG3(167826)

General description

The gene OLIG3 (Oligodendrocyte transcription factor-3) has been mapped to human chromosome 6q23.3. It belongs to a novel subfamily of basic helix-loop-helix transcription factors and consists of three members, OLIG1, OLIG2 and OLIG3. OLIG3 is expressed in the embryonic central nervous system, particularly in the dorsal neural tube from the midbrain/hindbrain boundary to the spinal cord.

Immunogen

Oligodendrocyte transcription factor 3 recombinant protein epitope signature tag (PrEST)

Application

Anti-OLIG3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

Oligodendrocyte transcription factor-3 (OLIG3) is essential for development of class-A neurons in the dorsal spinal cord and represses the emergence of class-B neurons. Wnt/β-catenin acts upstream of OLIG3 and controls expression of OLIG3, this regulates specification of spinal cord neurons. Single nucleotide polymorphism within OLIG3 reduces methotrexate monotherapy response in patients with inflammatory polyarthritis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73755

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

低风险生物材料
常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Marieke J H Coenen et al.
Human molecular genetics, 18(21), 4195-4203 (2009-08-04)
Recent genome-wide association studies (GWAS) have revealed genetic risk factors in autoimmune and inflammatory disorders. Several of the associated genes and underlying pathways are shared by various autoimmune diseases. Rheumatoid arthritis (RA) and coeliac disease (CD) are two autoimmune disorders
D Plant et al.
The pharmacogenomics journal, 12(2), 128-133 (2010-10-06)
Whole-genome association studies in rheumatoid arthritis have identified single-nucleotide polymorphisms (SNPs) predisposing to disease with moderate risk. We aimed to investigate the role of these markers in predicting methotrexate (MTX) response, measured by continuation on MTX monotherapy in patients with
H Takebayashi et al.
Mechanisms of development, 99(1-2), 143-148 (2000-11-25)
Basic helix-loop-helix (bHLH) transcription factors have been shown to be essential for specification of various cell types. Here, we describe a novel bHLH family consisting of three members, two of which (Olig1, Olig2) are expressed in a nervous tissue-specific manner
Dietmar Zechner et al.
Developmental biology, 303(1), 181-190 (2006-12-08)
In the developing spinal cord, signals of the roof plate pattern the dorsal progenitor domain and control the specification of three neuron types, dorsal interneurons dI1, dI2, and dI3. Bmp and Wnt/beta-catenin signals as well as transcription factors like Olig3
Hirohide Takebayashi et al.
Mechanisms of development, 113(2), 169-174 (2002-04-19)
Olig family is a novel sub-family of basic helix-loop-helix transcription factors recently identified. Olig1 and Olig2 were first reported to promote oligodendrocyte differentiation, and later Olig2 was reported to be involved in motoneuron specification as well. Olig3 was isolated as

Related Content

Prestige Antibodies Immunofluorescence Procedure

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service