Skip to Content
Merck
CN

HPA021479

Anti-HSD17B4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab3

Synonym(s):

Anti-17-beta-HSD 4, Anti-17-beta-hydroxysteroid dehydrogenase 4, Anti-D-bifunctional protein, Anti-DBP, Anti-MFE-2, Anti-Peroxisomal multifunctional enzyme type 2

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
immunoblotting
immunohistochemistry
Species reactivity:
human
Citations:
5
Technique(s):
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
Uniprot accession no.:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-HSD17B4 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab3

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... HSD17B4(3295)

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

HSD17B4 (17β-hydroxysteroid dehydrogenase type 4) enzyme plays a major role in β-oxidation of fatty acids and steroid metabolic process. Mutations in HSD17B4 gene lead to Zellweger syndrome and an autosomal recessive disorder called DBP (D-bifunctional protein) deficiency, both of which are generally fatal. Increase in the expression of peroxisomal protein leads to prostate cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

General description

17β-hydroxysteroid dehydrogenase type 4 (HSD17B4) gene is mapped to human chromosome 5q2. This gene is of more than 100kbp length. It consists of exons ranging from 21bp to 286bp and it encodes an 80kDa protein.
HSD17B4, also known as D-bifunctional protein (DBP), is highly expressed in liver, heart, prostate and testis. It is a 737 amino acid protein consisting of three functional domains N-terminal 3-hydroxyacyl-CoA dehydrogenase domain, a central 2-enoyl-CoA hydratase domain, and a C-terminal sterol carrier protein 2-like domain.

Immunogen

Peroxisomal multifunctional enzyme type 2 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST75489

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Unique multifunctional HSD17B4 gene product: 17beta-hydroxysteroid dehydrogenase 4 and D-3-hydroxyacyl-coenzyme A dehydrogenase/hydratase involved in Zellweger syndrome.
de Launoit Y
Journal of Molecular Endocrinology, 22(3), 227-240 (1999)
Kui Chen et al.
BMC medical genetics, 18(1), 91-91 (2017-08-24)
Perrault syndrome is a rare multisystem disorder that manifests with sensorineural hearing loss in both sexes, primary ovarian insufficiency in females and neurological features. The syndrome is heterogeneous both genetically and phenotypically. We reported a consanguineous family (two affected sisters)
David J Amor et al.
Neurology. Genetics, 2(6), e114-e114 (2016-10-30)
To determine the genetic cause of slowly progressive cerebellar ataxia, sensorineural deafness, and hypergonadotropic hypogonadism in 5 patients from 3 different families. The patients comprised 2 sib pairs and 1 sporadic patient. Clinical assessment included history, physical examination, and brain
Krishan K Rasiah et al.
Molecular and cellular endocrinology, 301(1-2), 89-96 (2008-12-23)
Steroid hormones and their metabolising enzymes have been studied extensively for their potential role in prostate cancer, with more recent interest in the androgen/estrogen inactivating enzyme 17beta-hydroxysteroid dehydrogenase type 4 (HSD17B4). Gene expression profiling showed HSD17B4 to be significantly overexpressed
Sarah B Pierce et al.
American journal of human genetics, 87(2), 282-288 (2010-08-03)
Perrault syndrome is a recessive disorder characterized by ovarian dysgenesis in females, sensorineural deafness in both males and females, and in some patients, neurological manifestations. No genes for Perrault syndrome have heretofore been identified. A small family of mixed European

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service