Skip to Content
Merck
CN

HPA031503

Sigma-Aldrich

Anti-ERLEC1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C2orf30, Anti-CL25084, Anti-ERLECTIN, Anti-Endoplasmic reticulum lectin 1, Anti-XTP3-B, Anti-XTP3TPB

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

SDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ERLEC1(27248)

General description

Endoplasmic reticulum lectin 1 (ERLEC1), also called Erlectin (XTP3-B), belongs to mannose 6-phosphate receptor homology (MRH) domain family. It has a signal peptide and two MRH domains. The ERLEC1 gene is mapped to human chromosome 2p16.2.

Immunogen

endoplasmic reticulum lectin 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Endoplasmic reticulum lectin 1 (ERLEC1) plays a key role in sorting of misfolded glycoproteins and their endoplasmic reticulum-associated degradation (ERAD). In mammals, ERLEC1 coordinates with amplified in osteosarcoma 9 (OS-9) and monitors protein misfolding and channelizes them for ubiquitin conjugation and degradation. It interacts with endoplasmic reticulum chaperones GRP94 (94-kDa glucose-regulated protein, an ER Hsp90 family member) and BiP (immunoglobulin heavy chain-binding protein, an ER Hsp70 family member) through the MRH domain.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST78933

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The MRH protein Erlectin is member of the endoplasmic reticulum synexpression group and functions in N-glycan recognition
Cruciat C, et al.
The Journal of Biological Chemistry, 281, 12986-12993 (2006)
Sweet bays of ERAD
Tamura T, et al.
Trends in Biochemical Sciences, 33(7), 298-300 (2008)
Human XTP3-B forms an ER quality-control scaffold with the HRD1-SEL1L ubiquitin ligase complex and BiP
Hosokawa N, et al.
The Journal of Biological Chemistry, 283(30), 20914-20924 (2008)
The Molecular Karyotype of 25 Clinical-Grade Human Embryonic Stem Cell Lines.
Canham MA, et al.
Scientific Reports, 5, 17258-17258 (2015)
John C Christianson et al.
Nature cell biology, 10(3), 272-282 (2008-02-12)
Terminally misfolded or unassembled proteins in the early secretory pathway are degraded by a ubiquitin- and proteasome-dependent process known as ER-associated degradation (ERAD). How substrates of this pathway are recognized within the ER and delivered to the cytoplasmic ubiquitin-conjugating machinery

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service