Skip to Content
Merck
CN

L7880

β-Lactoglobulin A from bovine milk

≥90% (PAGE)

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

CAS Number:
UNSPSC Code:
12352202
NACRES:
NA.61
MDL number:
Form:
powder
Assay:
≥90% (PAGE)
Biological source:
bovine milk
Mol wt:
18,363 Da by calculation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

bovine milk

assay

≥90% (PAGE)

form

powder

mol wt

18,363 Da by calculation

technique(s)

HPLC: suitable

UniProt accession no.

storage temp.

2-8°C

Quality Level

Gene Information

bovine ... LGB(280838)

Looking for similar products? Visit Product Comparison Guide

General description

Milk from dairy cows contains the protein β-lactoglobulin (BLG). It naturally occurs in a number of genetic variants, and the most prevalent bovine variants are known as BLG A and BLG B.
A member of the lipocalin family, βLg is a small protein of 162 amino acids with a molecular mass of ∼18,400 Da, featuring an eight-stranded β-barrel (strands A-H) succeeded by a three-turn a-helix and a final β-strand (strand I) that forms part of the dimerization interface.

Application

β-Lactoglobulin A from bovine milk has been used:
  • as a calibrant for the calibration of the TriWave device
  • as a standard in the detection and quantification of β-lactoglobulin in bovine milk by reverse-phase high performance liquid chromatography (HPLC)
  • in the purification and molecular weight measurement of protease samples

β-Lactoglobulin was used in the identification of the genetic variants of κ-casein in milk by isoelectric focusing electrophoresis.

Biochem/physiol Actions

β-Lactoglobulin (β-lg) possesses heat-set gelation properties. It also exhibits antiviral, anticarcinogenic and hypocholesterolemic effects. β-lg can bind to retinol and long-chain fatty acids. It may participate in the absorption and metabolism of fatty acids.

Storage Class

11 - Combustible Solids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, type N95 (US)

Regulatory Information

低风险生物材料
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

  1. Which document(s) contains shelf-life or expiration date information for a given product?

    If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis.

  2. How do I get lot-specific information or a Certificate of Analysis?

    The lot specific COA document can be found by entering the lot number above under the "Documents" section.

  3. How do I find price and availability?

    There are several ways to find pricing and availability for our products. Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote.  USA customers:  1-800-325-3010 or view local office numbers.

  4. What is the Department of Transportation shipping information for this product?

    Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product. 

  5. Do you have the amino acid sequence of Product L7880, β-Lactoglobulin A from bovine milk?

    Uniprot P02754 describes beta Lactoglobulin.The first 16 amino acids of that sequence are the signal peptide, so the sequence of beta-Lactoglobulin B corresponds to amino acids 17-178.But Product L7880 is beta-Lactoglobulin A. As shown in the details under the first link, this form of the protein varies by two amino acids from beta-Lactoglobulin B:1. Instead of the glycine (G) at position 80 of the B form, the A form has an aspartic acid (D).2. Instead of the alaline (A) at position 134 of the B form, the A form has a valine (V).So to answer your question, the sequence of Product L7880 is:LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

  6. My question is not addressed here, how can I contact Technical Service for assistance?

    Ask a Scientist here.

Bioactive milk proteins, peptides and lipids and other functional components derived from milk and bovine colostrum
Functional Foods, 471-511 (2011)
Jeremy Pronchik et al.
The journal of physical chemistry. B, 112(36), 11422-11434 (2008-08-19)
We use time-dependent fluorescence Stokes shift (TDFSS) information to study the fluctuation rates of the lipocalin, beta-lactoglobulin A in the vicinity of an encapsulated coumarin 153 molecule. The system has three unique dielectric environments in which the fluorophore binds. We
An Acid Protease Produced by Monilinia fructigena in vitro and in Infected Apple Fruits, and its Possible Role in Pathogenesis
Hislop EC, et al.
Microbiology, 128(4), 799-807 (1982)
DNA Binding and Phosphorylation Regulate the Core Structure of the NF-kappaB p50 Transcription Factor
Vonderach M, et al.
Journal of the American Society For Mass Spectrometry, 30(1), 128-138 (2019)
Detection and quantification of alphaS1-, alphaS2-, beta-, kappa-casein,alpha-lactalbumin, beta-lactoglobulin and lactoferrin in bovine milk by reverse-phase high-performance liquid chromatography
Maurmayr A, et al.
Agriculturae Conspectus Scientificus, 78(3), 201-205 (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service