Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
NACRES:
NA.12
UNSPSC Code:
23201100
Assay:
≥95% (SDS-PAGE)
Recombinant:
expressed in HEK 293 cells
General description
SILu™Prot MAPK1 is a recombinant, stable isotope-labeled human MAPK1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of MAPK1 in mass-spectrometry. SILu™Prot MAPK1 is a monomer of 380 amino acids (including polyhistidine and flag tags), with an apparent molecular weight of 44 kDa.
Biochem/physiol Actions
MAPK1 is a cytoplasmic protein that following activation is capable of translocating to the nucleus where it phosphorylates and regulates nuclear proteins (e.g., Elk-1, c-Myc, c-Jun, c-Fos, and C/EBP β). It is a protein serine/threonine kinase that is a member of the extracellular signal-regulated kinases (ERKs) which are activated in response to numerous growth factors and cytokines. Aberrations in the RAS-MAPK complex (of which MAPK1 is a downstream effector) are implicated in several human cancers, and this renders the pathway an attractive therapeutic target.
Physical form
Supplied as a 0.1 mg/mL solution of 20mM sodium phosphate, pH 8.0, 1M NaCl.
Other Notes
MDYKDDDDKGHHHHHHHHGGQAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Legal Information
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
signalword
Warning
hcodes
pcodes
Hazard Classifications
Eye Irrit. 2
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Related Content
Instructions
Global Trade Item Number
| SKU | GTIN |
|---|---|
| MSST0009-10UG | 04061833254912 |
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service