P7498
PDK1 Active human
recombinant, expressed in E. coli, ≥75% (SDS-PAGE), aqueous glycerol solution
Synonym(s):
3-phosphoinositide-dependent protein kinase
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
UNSPSC Code:
12352200
MDL number:
recombinant
expressed in E. coli
assay
≥75% (SDS-PAGE)
form
aqueous glycerol solution
specific activity
10 units/mg protein (Bradford)
mol wt
protein apparent mol wt ~59 kDa
shipped in
dry ice
storage temp.
−70°C
Gene Information
human ... PDPK1(5170)
Application
Kinase activity is measured as the molar amount of phosphate incorporated into PDKtide substrate peptide ([protein fragment, 39 aa]) per minute per mg protein at 30 °C using a final concentration of 50 microM [32P] ATP.
Biochem/physiol Actions
PDK1 plays a regulatory role in glucose and carbohydrate metabolism. It functions through the PI3K signaling cascade upstream of AKT1 as well as in other pathways involving proliferation, survival and cell migration.
Physical form
Solution of 50 μl in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.25 mM dithiothreitol (DTT), 0.1 mM EGTA, and 30% glycerol.
Other Notes
Human PDK1 is a 556-residue monomeric enzyme comprised of a catalytic domain that is most similar to the PKA, PKB and PKC subfamily of protein kinases and a C-terminal pleckstrin homology domain.
One unit will incorporate one nanomole of phosphate into the PDK tide substrate ([protein fragment, 39 aa]) per minute at 30 °C at pH 7.2 using a final concentration of 50 μM [32P] ATP.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Rosa Ferriero et al.
Journal of inherited metabolic disease, 38(5), 895-904 (2015-01-21)
Pyruvate dehydrogenase complex (PDHC) is a key enzyme in metabolism linking glycolysis to tricarboxylic acid cycle and its activity is tightly regulated by phosphorylation catalyzed by four pyruvate dehydrogenase kinase (PDK) isoforms. PDKs are pharmacological targets for several human diseases
Michael B Lazarus et al.
Bioorganic & medicinal chemistry, 23(17), 5483-5488 (2015-08-16)
Energy homeostasis in eukaryotic cells is a complex and fundamental process that is misregulated in several human diseases. A key component of energy regulation is a process called autophagy that involves the recycling of cellular components. There has been much
Related Content
Datasheet
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service