Skip to Content
Merck
CN

P7498

PDK1 Active human

recombinant, expressed in E. coli, ≥75% (SDS-PAGE), aqueous glycerol solution

Synonym(s):

3-phosphoinositide-dependent protein kinase

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352200
MDL number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

recombinant

expressed in E. coli

assay

≥75% (SDS-PAGE)

form

aqueous glycerol solution

specific activity

10 units/mg protein (Bradford)

mol wt

protein apparent mol wt ~59 kDa

UniProt accession no.

shipped in

dry ice

storage temp.

−70°C

Gene Information

human ... PDPK1(5170)

Application

Kinase activity is measured as the molar amount of phosphate incorporated into PDKtide substrate peptide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) per minute per mg protein at 30 °C using a final concentration of 50 microM [32P] ATP.

Biochem/physiol Actions

PDK1 plays a regulatory role in glucose and carbohydrate metabolism. It functions through the PI3K signaling cascade upstream of AKT1 as well as in other pathways involving proliferation, survival and cell migration.

Physical form

Solution of 50 μl in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.25 mM dithiothreitol (DTT), 0.1 mM EGTA, and 30% glycerol.

Other Notes

Human PDK1 is a 556-residue monomeric enzyme comprised of a catalytic domain that is most similar to the PKA, PKB and PKC subfamily of protein kinases and a C-terminal pleckstrin homology domain.
One unit will incorporate one nanomole of phosphate into the PDK tide substrate (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) per minute at 30 °C at pH 7.2 using a final concentration of 50 μM [32P] ATP.

Storage Class

12 - Non Combustible Liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rosa Ferriero et al.
Journal of inherited metabolic disease, 38(5), 895-904 (2015-01-21)
Pyruvate dehydrogenase complex (PDHC) is a key enzyme in metabolism linking glycolysis to tricarboxylic acid cycle and its activity is tightly regulated by phosphorylation catalyzed by four pyruvate dehydrogenase kinase (PDK) isoforms. PDKs are pharmacological targets for several human diseases
Michael B Lazarus et al.
Bioorganic & medicinal chemistry, 23(17), 5483-5488 (2015-08-16)
Energy homeostasis in eukaryotic cells is a complex and fundamental process that is misregulated in several human diseases. A key component of energy regulation is a process called autophagy that involves the recycling of cellular components. There has been much

Related Content

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service