Skip to Content
Merck
CN

SAB1400832

Sigma-Aldrich

Monoclonal Anti-CITED4 antibody produced in mouse

clone 4F6, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4F6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CITED4(163732)

General description

CITED4 (Cbp (CREB-binding protein)/p300-interacting transactivator 4) gene is mapped to human chromosome 1p34.2.

Immunogen

CITED4 (NP_597724.1, 131 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC

Biochem/physiol Actions

CITED4 (Cbp (CREB-binding protein)/p300-interacting transactivator 4) is a transcriptional cofactor. It is found to be downregulated in some of the tumor types including colorectal cancer. It is involved in the regulation of TGFB (transforming growth factor β1), TFAP2 (transcription factor A) and HIF1A (hypoxia inducible factor 1 αsubunit). It prevents the transactivation of HIF1A by inhibiting its binding to p300. CITED4 is known to be involved in the development of neural crest and neural tube.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

CITED4 inhibits hypoxia-activated transcription in cancer cells, and its cytoplasmic location in breast cancer is associated with elevated expression of tumor cell hypoxia-inducible factor 1alpha.
Fox SB
Cancer Research, 64(17), 6075-6081 (2004)
CITED4 gene silencing in colorectal cancer cells modulates adherens/tight junction gene expression and reduces cell proliferation.
Rogers MA
Journal of Cancer Research and Clinical Oncology, 142(1), 225-237 (2016)
Human CREB-binding protein/p300-interacting transactivator with ED-rich tail (CITED) 4, a new member of the CITED family, functions as a co-activator for transcription factor AP-2.
Braganca J
The Journal of Biological Chemistry, 277(10), 8559-8565 (2002)
Hypermethylation and transcriptional downregulation of the CITED4 gene at 1p34.2 in oligodendroglial tumours with allelic losses on 1p and 19q.
Tews B
Oncogene, 26(34), 5010-5016 (2007)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service