SAB1401128
Monoclonal Anti-EREG antibody produced in mouse
clone 1E6, purified immunoglobulin, buffered aqueous solution
Synonym(s):
ER
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1E6, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
capture ELISA: suitable, immunofluorescence: suitable
isotype
IgG1κ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
Gene Information
human ... EREG(2069)
General description
Epiregulin is a member of the epidermal growth factor family. Epiregulin can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors. (provided by RefSeq)
Immunogen
EREG (NP_001423, 32 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE
Sequence
STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE
Biochem/physiol Actions
The encoded protein epiregulin upon binding to the epidermal growth factor receptor causes dimerization and autophosphorylation of the receptor at its kinase domain. This event activates a number of intracellular signalling pathways. Epiregulin is known to induce progression of cancer especially in colon cancer cells. Overexpression of the gene EREG (epiregulin) is observed in human colon, breast and ovarian cancers. Upregulation and activation of epiregulin is known to elevate the phosphorylation of its receptor in glioblastoma thereby, promoting sphere formation, colony formation and tumor formation.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Shuli Liu et al.
Theranostics, 10(23), 10589-10605 (2020-09-16)
Rationale: The oncogenesis of head and neck squamous cell carcinoma (HNSCC) is believed to result from oncogene activation and tumor suppressor inactivation. Here, we identified a new oncogenic role for the EREG gene in HNSCC. Methods: The TCGA database and
Epiregulin Recognition Mechanisms by Anti-epiregulin Antibody 9E5: STRUCTURAL, FUNCTIONAL, AND MOLECULAR DYNAMICS SIMULATION ANALYSES.
Kado Y
The Journal of Biological Chemistry, 291(5) (2016)
Yuriko Katoh et al.
International journal of molecular medicine, 17(6), 1163-1166 (2006-05-11)
AREG (Amphiregulin), BTC (beta-cellulin), EGF, EPGN (Epigen), EREG (Epiregulin), HBEGF, NRG1, NRG2, NRG3, NRG4 and TGFA (TGFalpha) constitute EGF family ligands for ERBB family receptors. Cetuximab (Erbitux), Pertuzumab (Omnitarg) and Trastuzumab (Herceptin) are anti-cancer drugs targeted to EGF family ligands
Epiregulin enhances tumorigenicity by activating the ERK/MAPK pathway in glioblastoma.
Kohsaka S, et.al.
Neuro-Oncology, 16(7), 960-970 (2014)
Rafael González-Tajuelo et al.
Arthritis & rheumatology (Hoboken, N.J.), 72(3), 477-487 (2019-09-12)
Pulmonary arterial hypertension (PAH), one of the major complications of systemic sclerosis (SSc), is a rare disease with unknown etiopathogenesis and noncurative treatments. As mice deficient in P-selectin glycoprotein ligand 1 (PSGL-1) develop a spontaneous SSc-like syndrome, we undertook this
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service