Skip to Content
Merck
CN

SAB1401128

Sigma-Aldrich

Monoclonal Anti-EREG antibody produced in mouse

clone 1E6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

ER

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1E6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

capture ELISA: suitable
immunofluorescence: suitable

isotype

IgG1κ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... EREG(2069)

General description

Epiregulin is a member of the epidermal growth factor family. Epiregulin can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors. (provided by RefSeq)

Immunogen

EREG (NP_001423, 32 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE

Biochem/physiol Actions

The encoded protein epiregulin upon binding to the epidermal growth factor receptor causes dimerization and autophosphorylation of the receptor at its kinase domain. This event activates a number of intracellular signalling pathways. Epiregulin is known to induce progression of cancer especially in colon cancer cells. Overexpression of the gene EREG (epiregulin) is observed in human colon, breast and ovarian cancers. Upregulation and activation of epiregulin is known to elevate the phosphorylation of its receptor in glioblastoma thereby, promoting sphere formation, colony formation and tumor formation.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Shinji Kohsaka et al.
Neuro-oncology, 16(7), 960-970 (2014-01-29)
Glioblastoma multiforme (GBM) is one of the most aggressive human tumors, and the establishment of an effective therapeutic reagent is a pressing priority. Recently, it has been shown that the tumor tissue consists of heterogeneous components and that a highly
Canonical WNT signaling pathway and human AREG.
Katoh Y and Katoh M
International Journal of Molecular Medicine, 17(6), 1163-1166 (2006)
Epiregulin Recognition Mechanisms by Anti-epiregulin Antibody 9E5: STRUCTURAL, FUNCTIONAL, AND MOLECULAR DYNAMICS SIMULATION ANALYSES.
Kado Y
The Journal of Biological Chemistry, 291(5) (2016)
Shuli Liu et al.
Theranostics, 10(23), 10589-10605 (2020-09-16)
Rationale: The oncogenesis of head and neck squamous cell carcinoma (HNSCC) is believed to result from oncogene activation and tumor suppressor inactivation. Here, we identified a new oncogenic role for the EREG gene in HNSCC. Methods: The TCGA database and
Epiregulin enhances tumorigenicity by activating the ERK/MAPK pathway in glioblastoma.
Kohsaka S, et.al.
Neuro-Oncology, 16(7), 960-970 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service