SAB1403813
Monoclonal Anti-FGF8 antibody produced in mouse
clone 2A11, purified immunoglobulin, buffered aqueous solution
Synonym(s):
AIGF, HBGF-8, MGC149376
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2A11, monoclonal
form
buffered aqueous solution
mol wt
antigen ~33.6 kDa
species reactivity
human
technique(s)
capture ELISA: suitable
indirect ELISA: suitable
proximity ligation assay: suitable
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... FGF8(2253)
General description
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. (provided by RefSeq)
Immunogen
FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
Sequence
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
Biochem/physiol Actions
Fibroblast growth factor-8 (FGF-8) stimulates the proliferation and activation of cells that express the FGF receptors. It has a role in embryogenesis. FGF8b, an isoform of FGF-8, is expressed in prostate cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Screening a phage display library for a novel FGF8b-binding peptide with anti-tumor effect on prostate cancer.
Wang W
Experimental Cell Research, 319(8), 1156-1164 (2013)
A novel locus of ectodermal dysplasia maps to chromosome 10q24.32-q25.1.
Rafiq MA
The Journal of Investigative Dermatology, 124(2), 338-342 (2005)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service