SAB1412362
ANTI-TBX18 antibody produced in mouse
clone 4D3, purified immunoglobulin, buffered aqueous solution
Synonym(s):
TBX18
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
4D3, monoclonal
form
buffered aqueous solution
mol wt
antigen 37.4 kDa
species reactivity
, human,
technique(s)
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TBX18(9096)
General description
T-box transcription factor 18 (TBX18) belongs to the TBX family of transcription factors. It contains a conserved T-box domain and an N-terminal nuclear localization signal (NLS). The TBX18 gene is mapped to human chromosome 6q14.3
Immunogen
TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Application
ANTI-TBX18 antibody produced in mouse has been used in immunofluorescence staining.
Biochem/physiol Actions
T-box transcription factor 18 (TBX18) is involved in the sinoatrial node (SAN) formation and is expressed in the development and differentiation stages. It is a crucial factor for the pacemaker cell formation from cardiomyocytes. TBX18 may be implicated in congenital heart defects and congenital anomalies of the kidneys and urinary tract (CAKUT).
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Sergey Yechikov et al.
Stem cell research, 49, 102043-102043 (2020-11-01)
Directed cardiomyogenesis from human induced pluripotent stem cells (hiPSCs) has been greatly improved in the last decade but directed differentiation to pacemaking cardiomyocytes (CMs) remains incompletely understood. In this study, we demonstrated that inhibition of NODAL signaling by a specific
NODAL inhibition promotes differentiation of pacemaker-like cardiomyocytes from human induced pluripotent stem cells
Yechikov S, et al.
Stem Cell Research (2021)
Henner F Farin et al.
The Journal of biological chemistry, 282(35), 25748-25759 (2007-06-23)
Tbox18 (Tbx18) and Tbox15 (Tbx15) encode a closely related pair of vertebrate-specific T-box (Tbx) transcription factors. Functional analyses in the mouse have proven the requirement of Tbx15 in skin and skeletal development and of Tbx18 in the formation of the
Soumya Negi et al.
Developmental biology, 446(2), 180-192 (2018-12-31)
The evolutionarily conserved transcription factor, Tbx18, is expressed in a dynamic pattern throughout embryonic and early postnatal life and plays crucial roles in the development of multiple organ systems. Previous studies have indicated that this dynamic function is controlled by
Aafke Engwerda et al.
European journal of human genetics : EJHG, 26(10), 1478-1489 (2018-06-16)
Proximal 6q (6q11-q15) deletions are extremely rare and little is known about their phenotypic consequences. Since parents and caregivers now use social media to seek information on rare disorders, the Chromosome 6 Project has successfully collaborated with a Facebook group
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service