Skip to Content
Merck
CN

SAB2101053

Anti-HMOX1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BK286B10, Anti-HO-1, Anti-Heme oxygenase (decycling) 1

Sign In to View Organizational & Contract Pricing.

Select a Size

About This Item

UNSPSC Code:
12352203
MDL number:
MFCD01092544

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

33 kDa

species reactivity

pig, guinea pig, rabbit, human, rat, bovine, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

P09601

storage temp.

−20°C

Gene Information

human ... HMOX1(3162)

Looking for similar products? Visit Product Comparison Guide

Immunogen

The immunogen for anti-HMOX1 antibody: synthetic peptide derected towards the N terminal of human HMOX1

Physical form

Lyophilized from PBS buffer with 2% sucrose

Other Notes

Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC19060

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Chenghui Zhou et al.
The Journal of surgical research, 191(1), 51-57 (2014-04-22)
The role of heme oxygenase-1 (HO-1) in the cardioprotection induced by delayed remote ischemic preconditioning (DRIPC) has not been investigated. Therefore, this study was designed to investigate whether HO-1 is involved in DRIPC-mediated cardioprotection in an isolated perfused rat heart
Melissa A Allwood et al.
Cardiovascular pathology : the official journal of the Society for Cardiovascular Pathology, 23(4), 231-237 (2014-05-13)
Heme oxygenase-1 (HO-1) is a cytoprotective enzyme induced by stress. Heart failure is a condition of chronic stress-induced remodeling and is often accompanied by comorbidities such as age and hypertension. HO-1 is known to be protective in the setting of
D R do Val et al.
European journal of pain (London, England), 18(9), 1280-1289 (2014-04-10)
We investigated both the efficacy and the sub-chronic toxicity of Tephrosia toxicaria Pers. in the zymosan-induced temporomandibular joint (TMJ) inflammatory hypernociception in rats evaluating the possible role of heme oxygenase-1 (HO-1). Rats were pretreated with T. toxicaria (0.2, 2.0 or 20 mg/kg) 60 min
Zhe Wang et al.
Kidney international, 86(2), 338-349 (2014-04-11)
Rhabdomyolysis accounts for ∼10% of acute kidney injuries. In glycerol-induced myoglobinuric acute kidney injury, we found an increase in the nuclear factor erythroid 2-related factor 2 (Nrf2) nuclear protein, a key redox-sensitive transcription factor, and Nrf2-regulated genes and proteins including
Hiroshi Hada et al.
Biochimica et biophysica acta, 1840(7), 2351-2360 (2014-03-13)
Intracellular heme plays versatile roles in a variety of physiological processes including mitochondrial respiration. Heme also induces the expression of genes such as heme oxygenase-1 (HO-1) by inactivating the transcription repressor Bach1 through direct binding. However, the source of heme
View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service