SAB2103663
Anti-MCTS1, (N-terminal) antibody produced in rabbit
affinity isolated antibody, lyophilized powder
Synonym(s):
Anti-MCT1
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
MDL number:
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
20 kDa
species reactivity
canine, mouse, chicken, zebrafish, bovine, rabbit, human, rat
technique(s)
western blot: suitable
immunogen sequence
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... MCTS1(28985)
Immunogen
Peptide region of the protein sequence according to NP_054779.
Physical form
Antibody is lyophilized from PBS buffer with 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service