Skip to Content
Merck
CN

SAB2103935

Sigma-Aldrich

Anti-GZMK antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-TRYP2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

26 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GZMK(3003)

General description

Granzyme K (GZMK) also known as tryptase 2 (TRYP2), is a trypsin like serine protease, evolutionarily similar to granzyme A (GZMA). In human chromosome, the gene GZMK is localized on 5q11.2.

Immunogen

Synthetic peptide directed towards the middle region of human GZMK

Biochem/physiol Actions

GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes and natural killer cells. GZMK cleave after the basic amino acids like arginine or lysine. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface ′nonself′ antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. Gmzk expression level is higher in patients with sepsis and also in bronchoalveolar fluid with respiratory infections. GzmK can cause apoptosis by DNA fragmentation, and also by ROS (reactive oxygen species) production. GzmK triggers cleavage of p53, a proapoptotic protein and that potentiates apoptosis of tumor cells. Gzmk is highly expressed in NK cells and plays a key role in NK cells mediated tumor cell clearance. β-tubulin, a component of microtubule network is cleaved by Gzmk, which is crucial for maintaining the cell shape, mitosis and the intracellular trafficking.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: LRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPF

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Serine proteases of the human immune system in health and disease
Heutinck KM, et al.
Molecular Immunology, 47(11-12), 1943-1955 (2010)
Granule-associated serine proteases: granzymes might not just be killer proteases
Froelich CJ, et al.
Trends in Immunology, 30(3), 117-123 (2009)
The 2.2 A crystal structure of human pro-granzyme K reveals a rigid zymogen with unusual features
Hink-Schauer C, et al.
The Journal of Biological Chemistry, 277, 50923-50933 (2002)
Ignition of p53 bomb sensitizes tumor cells to granzyme K-mediated cytolysis
Hua G, et al.
Journal of Immunology, 182(4), 2152-2159 (2009)
Granzyme K displays highly restricted substrate specificity that only partially overlaps with granzyme A
Bovenschen N, et al.
The Journal of Biological Chemistry, 284(6), 3504-3512 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service