Skip to Content
Merck
CN

SAB2104393

Sigma-Aldrich

Anti-MARK3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CTAK1, Anti-KP78, Anti-PAR1A

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

81 kDa

species reactivity

rabbit, human, horse, rat, dog, mouse, bovine, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... MARK3(4140)

General description

The gene MARK3 (microtubule affinity regulating kinase 3) is mapped to human chromosome 14q32.3. It belongs to the Par-1 family of serine/threonine kinases.

Immunogen

Synthetic peptide directed towards the middle region of human MARK3

Biochem/physiol Actions

MARK3 (microtubule affinity regulating kinase 3) is activated by phosphorylation and is responsible for the phosphorylation of other proteins. Changes in the expression of MARK3 are associated with carcinogenesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Assignment of MARK3 alias KP78 to human chromosome band 14q32.3 by in situ hybridization.
T Ono et al.
Cytogenetics and cell genetics, 79(1-2), 101-102 (1997-01-01)
Su-Mei Xiao et al.
The Journal of clinical endocrinology and metabolism, 98(11), E1827-E1834 (2013-07-31)
Fifty-six genomic loci recently were identified as associated with bone mineral density (BMD) in a large meta-analysis study of mainly European-descent subjects. Circulating factors related to calcium and phosphate metabolism, eg, serum levels of calcium, phosphate, vitamin D metabolites, PTH

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service