biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
81 kDa
species reactivity
rabbit, human, horse, rat, dog, mouse, bovine, guinea pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... MARK3(4140)
Looking for similar products? Visit Product Comparison Guide
General description
The gene MARK3 (microtubule affinity regulating kinase 3) is mapped to human chromosome 14q32.3. It belongs to the Par-1 family of serine/threonine kinases.
Immunogen
Synthetic peptide directed towards the middle region of human MARK3
Biochem/physiol Actions
MARK3 (microtubule affinity regulating kinase 3) is activated by phosphorylation and is responsible for the phosphorylation of other proteins. Changes in the expression of MARK3 are associated with carcinogenesis.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Assignment of MARK3 alias KP78 to human chromosome band 14q32.3 by in situ hybridization.
T Ono et al.
Cytogenetics and cell genetics, 79(1-2), 101-102 (1997-01-01)
Su-Mei Xiao et al.
The Journal of clinical endocrinology and metabolism, 98(11), E1827-E1834 (2013-07-31)
Fifty-six genomic loci recently were identified as associated with bone mineral density (BMD) in a large meta-analysis study of mainly European-descent subjects. Circulating factors related to calcium and phosphate metabolism, eg, serum levels of calcium, phosphate, vitamin D metabolites, PTH
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service