Skip to Content
Merck
CN

SAB2108614

Anti-GADD45B

affinity isolated antibody

Synonym(s):

Anti- MYD118

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

18 kDa

species reactivity

bovine, human, dog, horse, pig, mouse, rat

concentration

0.5-1 mg/mL

technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

accession no.

NM_015675

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GADD45B(4616)

General description

Growth arrest and DNA damage-inducible 45 (GADD45B) gene is located on human chromosome 19p13.3.

Immunogen

Synthetic peptide directed towards the middle region of human GADD45B

Biochem/physiol Actions

sGrowth arrest and DNA damage-inducible 45 (GADD45B) acts as a tumor suppressor gene through p53-mediated apoptotic pathways. GADD45B helps to maintain chondrocyte homeostasis by regulating the expression of collagen gene.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Abnormal expression of GADD45B in human colorectal carcinoma
Wang, Lis, et al.
Journal of Translational Medicine, 10(1), 215-215 (2012)
Differential expression of GADD45$\beta$ in normal and osteoarthritic cartilage: potential role in homeostasis of articular chondrocytes
Ijiri, Ko, et al.
Arthritis and Rheumatism, 58(7), 2075-2087 (2008)
S Oesterreich et al.
British journal of cancer, 84(4), 493-498 (2001-02-24)
We have recently discovered that the nuclear matrix protein SAFB is an oestrogen receptor corepressor. Since it has become clear that many steroid receptor cofactors play important roles in breast tumorigenesis, we investigated whether SAFB could also be involved in
Liming Yu et al.
Nature communications, 14(1), 4101-4101 (2023-07-26)
Hypercholesterolemia and vascular inflammation are key interconnected contributors to the pathogenesis of atherosclerosis. How hypercholesterolemia initiates vascular inflammation is poorly understood. Here we show in male mice that hypercholesterolemia-driven endothelial activation, monocyte recruitment and atherosclerotic lesion formation are promoted by

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service