Skip to Content
Merck
CN

SAB5702226

Sigma-Aldrich

Anti-Ki67 Antibody, clone 5P6N6, Rabbit Monoclonal

Synonym(s):

KIA, MIB-, MIB-1, PPP1R105

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.46
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

material

colorless

clone

5P6N6, monoclonal

form

liquid

species reactivity

human, rat, rat

concentration

1 mg/mL

technique(s)

immunofluorescence: 1:50 - 1:200
immunohistochemistry: 1:50 - 1:400

color

colorless

isotype

IgG

immunogen sequence

LAGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MKI67(4288)

General description

This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Ki67 (NP_002408.3).
PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Application

IHC, IF/ICC

Pictograms

Exclamation markEnvironment

Signal Word

Warning

Hazard Statements

Hazard Classifications

Aquatic Chronic 2 - Skin Sens. 1

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service