SAE0223
Mpro, 3CL Protease from coronavirus MERS
recombinant protein, lyophilized product
Synonym(s):
3C Like proteinase, 3C-like main protease, 3CL Mpro, 3CL protease, 3CL proteinase, 3CLpro
Quality Level
form
lyophilized
shelf life
2 yr (Retest)
mol wt
33.3 kDa
sequence note
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ
NCBI accession no.
shipped in
dry ice
storage temp.
-10 to -25°C
General description
- Mpro (main protease)
- PLpro (Papain-like protease)
MERS Mpro, 3CL exists as a homodimer and each protomer has an active site. The proteolytic cleavage of 1ab polyprotein by Mpro occurs at 11 sites: 7 sites within the 1a polyprotein, and 11 sites within the 1ab polyprotein. This results in maturation of 16 viral non-structural proteins.Mpro protease forms a functional homodimer. Both the N-terminus and the C- terminus of Mpro have been shown to be critical for dimer formation and for enzyme function.
The Mpro protease, 3CLpro is an ideal target for antiviral drug design due to its high conservation between different coronavirus strains and absence of functional analogs in the human proteome. Mpro protease from SARS, MERS and SARS-CoV2 coronaviruses are functionally identical.
Features and Benefits
Mpro 3CL Protease is a cysteine protease. Mpro protease cleaves proteins with sequences including LQ[S/A/G) c-terminal to the glutamine residue.
Physical form
This product contains the complete sequence of Mpro protease [Uniprot No.: W5ZZQ8 (3248- 3553)] without any additional tags. The product is supplied lyophilized from 20 mM HEPES, 2.5% Trehalose, and 0.05% Tween 20.
Regulatory Information
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service