Skip to Content
Merck
CN

SAE0223

Mpro, 3CL Protease from coronavirus MERS

recombinant protein, lyophilized product

Synonym(s):

3C Like proteinase, 3C-like main protease, 3CL Mpro, 3CL protease, 3CL proteinase, 3CLpro

Sign Into View Organizational & Contract Pricing

Select a Size


Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Quality Level

form

lyophilized

shelf life

2 yr (Retest)

mol wt

33.3 kDa

sequence note

SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ

NCBI accession no.

shipped in

dry ice

storage temp.

-10 to -25°C

General description

Mpro, 3CL is a critical enzyme for the coronavirus life cycle. It activity yield non-structural proteins that are crucial for genome replication and Coronavirus virion production: RNA-dependent RNA polymerase, a helicase, ribonucleases and 3CLpro itself, from two types of polyproteins (pp1a and pp1ab). The maturation of MERS coronavirus depends on cleavage of the overlapping large polyproteins 1a and 1ab by two viral proteases:

  • Mpro (main protease)
  • PLpro (Papain-like protease)

MERS Mpro, 3CL exists as a homodimer and each protomer has an active site. The proteolytic cleavage of 1ab polyprotein by Mpro occurs at 11 sites: 7 sites within the 1a polyprotein, and 11 sites within the 1ab polyprotein. This results in maturation of 16 viral non-structural proteins.Mpro protease forms a functional homodimer. Both the N-terminus and the C- terminus of Mpro have been shown to be critical for dimer formation and for enzyme function.


The Mpro protease, 3CLpro is an ideal target for antiviral drug design due to its high conservation between different coronavirus strains and absence of functional analogs in the human proteome. Mpro protease from SARS, MERS and SARS-CoV2 coronaviruses are functionally identical.

Features and Benefits

Mpro, 3CL Protease (3C-like protease) is the main protease of Human MERS Coronavirus.

Mpro 3CL Protease is a cysteine protease. Mpro protease cleaves proteins with sequences including LQ[S/A/G) c-terminal to the glutamine residue.

Physical form

The product is supplied lyophilized from 20 mM HEPES, 2.5% Trehalose, and 0.05% Tween 20.

This product contains the complete sequence of Mpro protease [Uniprot No.: W5ZZQ8 (3248- 3553)] without any additional tags. The product is supplied lyophilized from 20 mM HEPES, 2.5% Trehalose, and 0.05% Tween 20.

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service