WH0000875M1
Monoclonal Anti-CBS antibody produced in mouse
clone 3E1, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-HIP4, Anti-cystathionine-beta-synthase
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3E1, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CBS(875)
General description
Cystathionine-β-synthase (CBS) also known as histone promoter control protein Hip4, is encoded by the gene mapped to human chromosome 21q22.3. CBS is a homotetramer containing 63kDa subunits. The encoded protein comprises C-terminal domain with a negative regulatory region, the middle domain with the catalytic core and heme-containing N-terminal domain.
The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. (provided by RefSeq)
Immunogen
CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Biochem/physiol Actions
Cystathionine-β-synthase (CBS) catalyzes the first step in the transsulfuration pathway, where serine and homocysteine is converted to cystathionine and water. In addition, it also acts as a catalyst for various alternative reactions involved in the synthesis of hydrogen sulfide, a novel neuromodulator in the brain. Deficiency of the gene is associated with the development of an autosomal recessive disorder, homocystinuria.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Structure of human cystathionine beta-synthase: a unique pyridoxal 5'-phosphate-dependent heme protein.
Meier M
The Embo Journal, 20, 3910-3916 (2001)
J Spencer Hauck et al.
Communications biology, 7(1), 9-9 (2024-01-04)
There are limited therapeutic options for patients with advanced prostate cancer (PCa). We previously found that heat shock factor 1 (HSF1) expression is increased in PCa and is an actionable target. In this manuscript, we identify that HSF1 regulates the
The role of cystathionine beta-synthase in homocysteine metabolism.
Jhee KH
Antioxidants & Redox Signaling, 7, 813-822 (2005)
Ana Hipólito et al.
Antioxidants (Basel, Switzerland), 13(1) (2024-01-22)
Lung cancer is a lethal disease with no truly efficient therapeutic management despite the progresses, and metabolic profiling can be a way of stratifying patients who may benefit from new therapies. The present study is dedicated to profiling cysteine metabolic
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service