Skip to Content
Merck
CN

WH0000922M1

Sigma-Aldrich

Monoclonal Anti-CD5L antibody produced in mouse

clone 1C8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-API6, Anti-CD5 antigen-like (scavenger receptor cysteine rich family), Anti-PRO229, Anti-SPALPHA, Anti-Spalpha

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1C8, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CD5L(922)

General description

CD5 molecule like (CD5L), also known as apoptosis inhibitor of macrophage (AIM), is encoded by the gene mapped to human chromosome 1q23.1. CD5L is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. It is a soluble protein expressed generally by macrophages in lymphoid and inflamed tissues. This protein is characterized with a potential region of O-linked glycosylation in a Pro-Ser-Thr-rich polypeptide, separating SRCR domains 1 and 2.

Immunogen

CD5L (AAH33586, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL

Biochem/physiol Actions

CD5 molecule like (CD5L) controls lipid metabolism and regulates T-helper (Th) 17 cell pathogenicity. In addition, it also has an ability to regulate leukocyte migration and inflammatory responses. Overexpression of the protein has been observed in atopic dermatitis (AD) patients. Thus, it can be used as a potential biomarker for AD.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

1q23. 1 homozygous deletion and downregulation of Fc receptor-like family genes confer poor prognosis in chronic lymphocytic leukemia
Daniele G, et al.
Clinical and Experimental Medicine, 1-7 (2019)
AIM/CD5L: a key protein in the control of immune homeostasis and inflammatory disease
Sanjurjo L, et al.
Journal of Leukocyte Biology, 98(2), 173-184 (2015)
CD5L/AIM regulates lipid biosynthesis and restrains Th17 cell pathogenicity
Wang C, et al.
Cell, 163(6), 1413-1427 (2015)
Glycoproteomic analysis of plasma from patients with atopic dermatitis: CD5L and ApoE as potential biomarkers
Kim W, et al.
Experimental & Molecular Medicine, 40(6), 677-677 (2008)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service