WH0001072M4
Monoclonal Anti-CFL1 antibody produced in mouse
clone 1A1, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-CFL, Anti-cofilin 1 (non-muscle)
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1A1, monoclonal
form
buffered aqueous solution
species reactivity
mouse, human, rat
technique(s)
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CFL1(1072)
General description
Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
The cofilin 1 (CFL1) gene with four exons is mapped to human chromosome 11q13.1. The gene codes for an ubiquitously expressed, 18.5kDa phosphoprotein.
Immunogen
CFL1 (AAH11005, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Biochem/physiol Actions
Cofilin-l (CFL1) plays a vital role in the regulation of actin cytoskeleton reorganization. It is also implicated in cancer cell migration and invasion in several types of tumor tissues. Elevated expression of the gene is associated with the development of esophageal squamous cell carcinoma (ESCC). In addition, abnormal expression of the gene leads to vulvar cancer and thus, it can be considered as a potential therapeutic target for the same. CFL1 facilitates cytokinesis, cell motility and morphogenesis. Activated CFL1 helps in preventing cytoskeletal-associated defects in axonal development stimulated by synucleins (Syns).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Cofilin 1 activation prevents the defects in axon elongation and guidance induced by extracellular alpha-synuclein.
Tilve S
Scientific Reports (2015)
Association between CFL1 gene polymorphisms and spina bifida risk in a California population.
Zhu H
BMC Medical Genetics (2007)
The role of cofilin-l in vulvar squamous cell carcinoma: A marker of carcinogenesis, progression and targeted therapy.
Wu Q
Oncology Reports, 35, 2743-2754 (2016)
Sreenath Ravindran et al.
Frontiers in molecular neuroscience, 12, 64-64 (2019-04-06)
Dendritic growth and branching are highly regulated processes and are essential for establishing proper neuronal connectivity. There is a critical phase of early dendrite development when these are heavily regulated by external cues such as trophic factors. Brain-derived neurotrophic factor
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service