WH0001591M7
Monoclonal Anti-CYP24A1 antibody produced in mouse
clone 1F8, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-CP24, Anti-CYP24, Anti-MGC126273, Anti-MGC126274, Anti-P450CC24, Anti-cytochrome P450, family 24, subfamily A, polypeptide 1
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1F8, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
ELISA: suitable
capture ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CYP24A1(1591)
General description
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)
Immunogen
CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Biochem/physiol Actions
Cytochrome P450 family 24 subfamily A member 1 (CYP24A1) plays a vital role in side-chain oxidation of steroid hormone vitamin D. Variation in or increased expression of CYP24A1 results in colorectal cancer (CRC); thus, CYP24A1 has potential as a biomarker for CRC. Biallelic mutation of CYP24A1 is observed in patients with idiopathic infantile hypercalcemia (IIH), low parathyroid hormone (PTH), renal disease, and it might also increase the risk of nephrocalcinosis in adults. Promoter polymorphism in the CYP24A1 gene leads to thechronic inflammatory skin disease called atopic dermatitis (AD) in adults. CYP24A1 transcript is highly expressed in ovary and lung tumors, but its expression is decreased in breast tumor when compared to the analogous normal tissues.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Calcium and bone homeostasis in heterozygous carriers of CYP24A1 mutations: A cross-sectional study.
M Cools et al.
Bone, 81, 89-96 (2015-06-29)
Bi-allelic CYP24A1 mutations can cause idiopathic infantile hypercalcemia (IIH), adult-onset nephrocalcinosis, and possibly bone metabolism disturbances. It is currently unclear if heterozygous carriers experience clinical problems or biochemical abnormalities. Our objective is to gain insight in the biochemical profile and
Nicole Ball et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 38(3), 414-426 (2023-01-11)
Loss-of-function mutations in the CYP24A1 protein-coding region causing reduced 25 hydroxyvitamin D (25OHD) and 1,25 dihydroxyvitamin D (1,25(OH)2 D) catabolism have been observed in some cases of infantile hypercalcemia type 1 (HCINF1), which can manifest as nephrocalcinosis, hypercalcemia and adult-onset
Xabier Garcia-Albeniz et al.
British journal of cancer, 114(2), 221-229 (2016-01-15)
Menopausal hormone therapy (MHT) use has been consistently associated with a decreased risk of colorectal cancer (CRC) in women. Our aim was to use a genome-wide gene-environment interaction analysis to identify genetic modifiers of CRC risk associated with use of
Hongyan Sun et al.
Human pathology, 50, 101-108 (2016-03-22)
Our study aims to fully evaluate clinicopathological and prognostic values of CYP24A1 in colorectal cancer (CRC) patients. Tissue microarrays of formalin-fixed and paraffin-embedded tumor samples and matched adjacent nontumor colorectal tissues from 99 CRC patients were studied for CYP24A1 protein
Jana Hallau et al.
Acta dermato-venereologica, 96(2), 169-172 (2015-09-01)
Atopic dermatitis (AD) is a chronic inflammatory skin disease in which genetic and environmental factors result in impaired epidermal barrier functioning and an altered immune response. Vitamin D influences these 2 pathomechanisms, and beneficial results have been suggested in AD.
Articles
Phase I biotransformation reactions increase drug compound polarity, mainly occurring in hepatic circulation.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service