WH0002027M1
Monoclonal Anti-ENO3 antibody produced in mouse
clone 5D1, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-MSE, Anti-enolase 3 (beta, muscle)
Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
5D1, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, indirect ELISA: suitable, indirect immunofluorescence: suitable, western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
Gene Information
human ... ENO3(2027)
General description
ENO3 (enolase 3) gene codes for enolase enzyme. This isoenzyme is present in skeletal and cardiac muscle cells. This gene is located on human chromosome 17pter-p11 b.
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5′ UTR. (provided by RefSeq)
Immunogen
ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Biochem/physiol Actions
Mutations in ENO3 (enolase 3) is linked with metabolic myopathies that may occur due to decreased stability of the enzyme. It catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate. ENO3 possess several methylation properties.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
12 - Non Combustible Liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Gene expression profile of rat left ventricles reveals persisting changes following chronic mild exercise protocol: implications for cardioprotection
Giusti B, et al.
BMC Genomics (2009)
The implications of human metabolic network topology for disease comorbidity
Lee DS, et al.
Proceedings of the National Academy of Sciences of the USA, 105(29), 9880-9885 (2008)
Methylation patterns in the human muscle-specific enolase gene (ENO3)
Peshavaria M and Day IN
The Biochemical Journal (1993)