Skip to Content
Merck
CN

WH0003484M1

Sigma-Aldrich

Monoclonal Anti-IGFBP1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-AFBP, Anti-IBP1, Anti-IGFBP25, Anti-PP12, Anti-hIGFBP1, Anti-insulin-like growth factor binding protein 1

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F9, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IGFBP1(3484)

General description

Insulin-like growth factor binding protein 1 (IGFBP1) is a ~30 kDa secretory protein. It is formed mostly in the liver and kidney. IGFBP1 is a member of the IGFBPs family. This gene is located on human chromosome 7p12.
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. (provided by RefSeq)

Immunogen

IGFBP1 (NP_000587, 160 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Biochem/physiol Actions

Insulin-like growth factor binding protein 1 (IGFBP1) participates in the modulation of fetal growth through the insulin-like growth factor axis. Due to its high-affinity binding, IGFBP1 also controls the IGF bioactivity. It has the capability to bind and regulate the bioavailability of circulating insulin-like growth factors (IGFs).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Biallelic expression of IGFBP1 and IGFBP3, two candidate genes for the Silver-Russell syndrome
Wakeling EL, et al.
Journal of medical Genetics, 37(1), 65-67 (2000)
Association of Circulating IGFBP1 Level with the Severity of Coronary Artery Lesions in Patients with Unstable Angina
Zheng W, et al.
Disease Markers (2017)
Hepatic IGFBP1 is a prosurvival factor that binds to BAK, protects the liver from apoptosis, and antagonizes the proapoptotic actions of p53 at mitochondria
Leu JI and George DL
Genes & Development, 21(23), 3095-3109 (2007)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service