Skip to Content
Merck
CN

WH0005291M1

Sigma-Aldrich

Monoclonal Anti-PIK3CB antibody produced in mouse

clone 4H2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DKFZp779K1237, Anti-PI3K, Anti-PI3Kbeta, Anti-PIK3C1, Anti-p110BETA, Anti-phosphoinositide-3-kinase, catalytic, beta polypeptide

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4H2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... PIK3CB(5291)

General description

PIK3CB (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit β) belongs to the phosphatidylinositol 3-kinase (PI3 kinase) family. It is located on human chromosome 3q22.

Immunogen

PIK3CB (NP_006210, 147 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY

Biochem/physiol Actions

PIK3CB (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit β) controls several cellular processes like cell survival, proliferation, cell cycle progression, angiogenesis, invasion and metastasis. It plays a major role in the development of CRC (colorectal cancer).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A common polymorphism of the growth hormone receptor is associated with increased responsiveness to growth hormone
Dos Santos C, et al.
Nature Genetics, 36(7), 720-724 (2004)
Molecular pharmacology of phosphatidylinositol 3-kinase inhibition in human glioma
Guillard S, et al.
Cell Cycle, 8(3), 443-453 (2009)
Feifei Wen et al.
International journal of clinical and experimental pathology, 7(11), 8295-8303 (2015-01-01)
The phosphoinositide 3-kinases (PI3Ks) are a critical family of signaling enzymes that participate in many cellular processes that promote the transformation of a normal cell into a cancer cell. These processes include cancer cell proliferation, migration, and invasion. However, the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service