Skip to Content
Merck
CN

WH0005889M1

Sigma-Aldrich

Monoclonal Anti-RAD51C antibody produced in mouse

clone 3F3-5C6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-RAD51 homolog C (S. cerevisiae), Anti-RAD51L2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3F3-5C6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RAD51C(5889)

General description

RAD51 paralog C (RAD51C) is a tumor suppressor gene. It belongs to the RAD51-like gene family and the gene encoding it is localized on human chromosome 17q23.

Immunogen

RAD51C (AAH00667.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL

Biochem/physiol Actions

RAD51 paralog C (RAD51C) aids in the recruitment of the enzyme RAD51 to DNA break sites. It may be involved in modulating its translocation from the cytoplasm to the nucleus. RAD51C has a role in genomic stability and homologous recombination repair. It has been associated with breast and ovarian cancer. Mutations in the gene encoding RAD51C have been linked to Fanconi anemia.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Estrogen induces RAD51C expression and localization to sites of DNA damage.
Alayev A
Cell Cycle (2016)
High expression of Rad51c predicts poor prognostic outcome and induces cell resistance to cisplatin and radiation in non-small cell lung cancer.
Chen X
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service