biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3B3, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable, western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
Gene Information
human ... SLC6A5(9152)
General description
SLC6A5 (solute carrier 6A5) gene codes for the neuronal GlyT2 glycine transporter. GlyT2 is a member of the SLC6 solute carrier family of neurotransmitter sodium symporters. This gene is located on human chromosome 11p15.
Immunogen
SLC6A5 (NP_004202, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR
Sequence
TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR
Biochem/physiol Actions
SLC6A5 (solute carrier 6A5) is a neurotransmitter transporter, which helps to maintain a high presynaptic pool of glycine at glycinergic synapses. It participates in the removal and recycling of glycine from inhibitory synapses. Mutations in GlyT2 gene result in presynaptic hyperekplexia and startle disease.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
12 - Non Combustible Liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Association study of polymorphisms in the neutral amino acid transporter genes SLC1A4, SLC1A5 and the glycine transporter genes SLC6A5, SLC6A9 with schizophrenia
Deng X, et al.
BMC Psychiatry (2008)
Molecular basis of the dominant negative effect of a glycine transporter 2 mutation associated with hyperekplexia
Arribas-Gonzalez E, et al.
The Journal of Biological Chemistry, 290(4), 2150-2165 (2015)
Mutations in the GlyT2 gene (SLC6A5) are a second major cause of startle disease
Carta E, et al.
The Journal of Biological Chemistry, 287(34), 28975-28985 (2012)